NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088862

Metagenome / Metatranscriptome Family F088862

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088862
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 48 residues
Representative Sequence ALNAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Number of Associated Samples 100
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.17 %
% of genes near scaffold ends (potentially truncated) 88.07 %
% of genes from short scaffolds (< 2000 bps) 88.07 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.982 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.110 % of family members)
Environment Ontology (ENVO) Unclassified
(28.440 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.119 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 0.00%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00072Response_reg 63.30
PF07992Pyr_redox_2 9.17
PF01135PCMT 6.42
PF00027cNMP_binding 4.59
PF08281Sigma70_r4_2 3.67
PF12831FAD_oxidored 2.75
PF04545Sigma70_r4 1.83
PF00890FAD_binding_2 1.83
PF02148zf-UBP 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 6.42
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 6.42
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 6.42
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 6.42
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.98 %
UnclassifiedrootN/A22.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01DQ8KIAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces676Open in IMG/M
3300000956|JGI10216J12902_109105549Not Available585Open in IMG/M
3300004643|Ga0062591_101597862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus657Open in IMG/M
3300005173|Ga0066822_1005685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales714Open in IMG/M
3300005181|Ga0066678_10276929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1092Open in IMG/M
3300005332|Ga0066388_103842569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria766Open in IMG/M
3300005337|Ga0070682_100036572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales3002Open in IMG/M
3300005354|Ga0070675_100084076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2657Open in IMG/M
3300005363|Ga0008090_14843752All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005434|Ga0070709_10378555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1052Open in IMG/M
3300005434|Ga0070709_11587805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus532Open in IMG/M
3300005437|Ga0070710_10030790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2890Open in IMG/M
3300005467|Ga0070706_100221630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1765Open in IMG/M
3300005577|Ga0068857_101865302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300005718|Ga0068866_10336465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium955Open in IMG/M
3300006573|Ga0074055_11642441Not Available599Open in IMG/M
3300006605|Ga0074057_10033586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia993Open in IMG/M
3300006755|Ga0079222_11506382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300006871|Ga0075434_101503606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus682Open in IMG/M
3300007265|Ga0099794_10413474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300009090|Ga0099827_10449203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300009177|Ga0105248_10108803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces3125Open in IMG/M
3300009553|Ga0105249_11788379Not Available687Open in IMG/M
3300009792|Ga0126374_10869487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii696Open in IMG/M
3300009839|Ga0116223_10580417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300010046|Ga0126384_10435667Not Available1115Open in IMG/M
3300010047|Ga0126382_12143841Not Available536Open in IMG/M
3300010048|Ga0126373_11617202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria712Open in IMG/M
3300010379|Ga0136449_100184889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4000Open in IMG/M
3300010379|Ga0136449_103555208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300010396|Ga0134126_12290553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces589Open in IMG/M
3300011119|Ga0105246_11968921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus563Open in IMG/M
3300012199|Ga0137383_10772586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus701Open in IMG/M
3300012200|Ga0137382_10683366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300012209|Ga0137379_10042973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4360Open in IMG/M
3300012210|Ga0137378_11833939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus510Open in IMG/M
3300012477|Ga0157336_1005255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium848Open in IMG/M
3300012924|Ga0137413_11014860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus651Open in IMG/M
3300012971|Ga0126369_12328824Not Available622Open in IMG/M
3300014745|Ga0157377_10033609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alni2800Open in IMG/M
3300014745|Ga0157377_11506844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus535Open in IMG/M
3300015356|Ga0134073_10329543Not Available554Open in IMG/M
3300016319|Ga0182033_11718346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus569Open in IMG/M
3300016341|Ga0182035_11945703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus534Open in IMG/M
3300016371|Ga0182034_11556328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300016445|Ga0182038_11202964Not Available676Open in IMG/M
3300017943|Ga0187819_10011448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5034Open in IMG/M
3300020170|Ga0179594_10244539Not Available676Open in IMG/M
3300020199|Ga0179592_10298591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300020580|Ga0210403_11484746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces510Open in IMG/M
3300021171|Ga0210405_11007842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus627Open in IMG/M
3300021402|Ga0210385_11511879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces513Open in IMG/M
3300021404|Ga0210389_10995012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus650Open in IMG/M
3300021405|Ga0210387_10929728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300021420|Ga0210394_10240491Not Available1584Open in IMG/M
3300021478|Ga0210402_10952524Not Available785Open in IMG/M
3300021478|Ga0210402_11037340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300021559|Ga0210409_10437991Not Available1166Open in IMG/M
3300024283|Ga0247670_1005661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alni2375Open in IMG/M
3300025735|Ga0207713_1240260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cahuitamycinicus538Open in IMG/M
3300025898|Ga0207692_10143048Not Available1362Open in IMG/M
3300025906|Ga0207699_10036084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alni2816Open in IMG/M
3300025906|Ga0207699_10821525Not Available684Open in IMG/M
3300025910|Ga0207684_11676688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces513Open in IMG/M
3300025929|Ga0207664_11787202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus537Open in IMG/M
3300025939|Ga0207665_10393045Not Available1054Open in IMG/M
3300026326|Ga0209801_1308065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus562Open in IMG/M
3300026494|Ga0257159_1055437Not Available676Open in IMG/M
3300027505|Ga0209218_1142140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces507Open in IMG/M
3300027765|Ga0209073_10237332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300027875|Ga0209283_10305010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300028536|Ga0137415_10652386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300028787|Ga0307323_10283210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus596Open in IMG/M
3300028807|Ga0307305_10097772Not Available1356Open in IMG/M
3300028828|Ga0307312_11175042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces507Open in IMG/M
3300029636|Ga0222749_10263038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria881Open in IMG/M
3300030707|Ga0310038_10411274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus586Open in IMG/M
3300031543|Ga0318516_10376014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300031543|Ga0318516_10602254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300031564|Ga0318573_10030315All Organisms → cellular organisms → Bacteria2526Open in IMG/M
3300031748|Ga0318492_10655277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus561Open in IMG/M
3300031768|Ga0318509_10495480Not Available683Open in IMG/M
3300031770|Ga0318521_10524099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300031771|Ga0318546_10582757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300031779|Ga0318566_10323973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300031779|Ga0318566_10521263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus581Open in IMG/M
3300031782|Ga0318552_10337207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300031832|Ga0318499_10367355Not Available552Open in IMG/M
3300031845|Ga0318511_10513203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus555Open in IMG/M
3300031910|Ga0306923_11131505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300031945|Ga0310913_11097170Not Available556Open in IMG/M
3300031947|Ga0310909_10369636Not Available1204Open in IMG/M
3300031947|Ga0310909_10472433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1052Open in IMG/M
3300031959|Ga0318530_10403152Not Available567Open in IMG/M
3300032001|Ga0306922_10199388All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300032001|Ga0306922_11852627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus592Open in IMG/M
3300032009|Ga0318563_10644374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus570Open in IMG/M
3300032054|Ga0318570_10268655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300032065|Ga0318513_10278602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300032066|Ga0318514_10188949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300032067|Ga0318524_10018013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces3112Open in IMG/M
3300032094|Ga0318540_10060613All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300032174|Ga0307470_10156487Not Available1401Open in IMG/M
3300032261|Ga0306920_100990776Not Available1224Open in IMG/M
3300032782|Ga0335082_11473186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus552Open in IMG/M
3300032828|Ga0335080_11103458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300033290|Ga0318519_10598685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium669Open in IMG/M
3300033475|Ga0310811_10594468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300034819|Ga0373958_0127454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glebosus620Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.11%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.92%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005173Soil and rhizosphere microbial communities from Laval, Canada - mgHMAEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_025699402170459017Switchgrass, Maize And Mischanthus LitterADQIEPCTDGLIPIRARILVRAGVPWPQAFALSRYWLGPK
JGI10216J12902_10910554923300000956SoilAADQIEPCTDGLIPIRARILARAGVPWPQAFAMSRYWLGPK*
Ga0062591_10159786223300004643SoilALNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0066822_100568513300005173SoilAADQIEPCTDGPEGLIPIRARILARAGVPWPQAFAMSRYWLGPK*
Ga0066678_1027692923300005181SoilLALNAAAEQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0066388_10384256923300005332Tropical Forest SoilGCDPFNFGDFVWLALHSAADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK*
Ga0070682_10003657233300005337Corn RhizosphereAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0070675_10008407633300005354Miscanthus RhizosphereDQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0008090_1484375223300005363Tropical Rainforest SoilADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK*
Ga0070709_1037855513300005434Corn, Switchgrass And Miscanthus RhizosphereLRRALHAAADQVEPCTDGLAPIRARILARAGVPWPQALAISRYWLGPK*
Ga0070709_1158780523300005434Corn, Switchgrass And Miscanthus RhizosphereRLALNAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0070710_1003079013300005437Corn, Switchgrass And Miscanthus RhizosphereALHAAADQVEPCTDGLAPIRARILARAGVPWPQALAISRYWLGPK*
Ga0070706_10022163013300005467Corn, Switchgrass And Miscanthus RhizosphereDFGDFVRIALNAAADQIEPCTDGPEGLVPIRARILARAGVPWPQAFAMSRYWLGPK*
Ga0068857_10186530213300005577Corn RhizosphereRRALHAAADQIEPQPDGLAPIRARILTSAGVPWKQAFAISQYWIHDA*
Ga0068866_1033646523300005718Miscanthus RhizosphereDQIEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0074055_1164244113300006573SoilGDFVRIALNTAADQIEPCTDGPEGLIPIRARILARAGVPWPQAFAMSRYWLGPK*
Ga0074057_1003358613300006605SoilQIEPCTDGPEGLIPIRARILARAGVPWPQAFAMSRYWLGPK*
Ga0079222_1150638223300006755Agricultural SoilFGEYLRRALHAAADQVEPQPDGLAPIRARILTSAGVPWKQAFAISQYWIHDA*
Ga0075434_10150360613300006871Populus RhizosphereGDFVRLALNAAADQIEPCTDGLIPIRARILVRAGVPWPQAFALSRYWLGPK*
Ga0099794_1041347413300007265Vadose Zone SoilLNFGDIVRLALYAAADQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0099827_1044920323300009090Vadose Zone SoilLNFAEFVRLALHAAADQVEPRADGLAPIRARILAGAGVPWPQAFAISQYWLGPK*
Ga0105248_1010880313300009177Switchgrass RhizosphereEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0105249_1178837913300009553Switchgrass RhizosphereADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0126374_1086948723300009792Tropical Forest SoilVWLALHSAADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK*
Ga0116223_1058041723300009839Peatlands SoilLNFAEFVRLALHAAADQVEPRADGLAPIRARILAAAGVPWPRALAISQYWLGPQ*
Ga0126384_1043566723300010046Tropical Forest SoilDGHEGLIPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0126382_1214384123300010047Tropical Forest SoilFVRLALHAAADQVEPCTDGLVPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0126373_1161720213300010048Tropical Forest SoilVFAEFLRRALHTAADQVEPCADGLAPIRARILARAGVPWPQALAISRYWLGPK*
Ga0136449_10018488923300010379Peatlands SoilLSFADFVRLALYAAADQLEPRGDGLAPIRAKILAAAGVPWAKALAISRYWLGPK*
Ga0136449_10355520823300010379Peatlands SoilLSFAEFLRLALHAAADQVEPRADGLAPIRARILAAAGVPWAKALAISRYWLGPK*
Ga0134126_1229055323300010396Terrestrial SoilVSPPVFAEFLRRALHAAADQVEPCTDGLAPIRARILARAGVPWPQALAISRYWLGPK*
Ga0105246_1196892113300011119Miscanthus RhizosphereMDFGEYLRRALHAAADQVEPQPDGLAPIRARILTSAGVPWKQAFAISQYWIHDA*
Ga0137383_1077258613300012199Vadose Zone SoilLGDFVRLALNAAAEQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0137382_1068336623300012200Vadose Zone SoilLGDFVRLALNAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0137379_1004297323300012209Vadose Zone SoilLNFAEFVRLALHTAADQVEPRPDGLAPIRARILAGAGVPWRQAFAISQYWLGPK*
Ga0137378_1183393913300012210Vadose Zone SoilEPCADGLVSIRARILAGSGVPWPQALALSLYWLDPKRKS*
Ga0157336_100525523300012477Arabidopsis RhizosphereAADQIEPCTDGPEGLVPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0137413_1101486013300012924Vadose Zone SoilARGRDFGDFVRLALNAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWPGPK*
Ga0126369_1232882413300012971Tropical Forest SoilVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK*
Ga0157377_1003360913300014745Miscanthus RhizosphereNAAADQIEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK*
Ga0157377_1150684423300014745Miscanthus RhizosphereFVRLALNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0134073_1032954313300015356Grasslands SoilLNAAADQIEPCTDGLVPIRARILARAGVPWPQAFALSRYWLGPK*
Ga0182033_1171834623300016319SoilGEFVRVALHAAADQVEPCTDGLVPIRARILARAGVPWPQAFAVSRYWLGPK
Ga0182035_1194570323300016341SoilGDFVRLALQSAADQVEPCTDGPEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0182034_1155632823300016371SoilGDFVRLALHAAADQVEPCVDGPDGLVPIRARILARSGVPWPQAFALSRYWLGPK
Ga0182038_1120296423300016445SoilVRGRDFGDFVRLALHAAADQVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK
Ga0187819_1001144863300017943Freshwater SedimentVRLALQAAADQVEPRADGLVPIRARILAAAGVPWPKALAISQYWLGPP
Ga0179594_1024453913300020170Vadose Zone SoilAADQIEPCADGPDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0179592_1029859113300020199Vadose Zone SoilAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0210403_1148474623300020580SoilALHAAADQIEPCSDGLEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0210405_1100784223300021171SoilGDIVRLALHAAADQIEPCSDGLEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0210385_1151187913300021402SoilYALQAAADQVDPHADVLVPIRARILAGAGIPWPQAFAISLNWIHDA
Ga0210389_1099501213300021404SoilDQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0210387_1092972813300021405SoilALRAATDQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0210394_1024049113300021420SoilDFGDFVRLALNTAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0210402_1095252423300021478SoilLHAAADQVEPCTDGLAPIRARILARAGVPWPQALAISRYWLGPK
Ga0210402_1103734013300021478SoilLHAAADQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0210409_1043799113300021559SoilPCSDGLEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0247670_100566133300024283SoilFVYRALNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0207713_124026023300025735Switchgrass RhizosphereARGRDFGDFVRLALNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0207692_1014304813300025898Corn, Switchgrass And Miscanthus RhizosphereEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0207699_1003608413300025906Corn, Switchgrass And Miscanthus RhizosphereDFVRLALNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0207699_1082152523300025906Corn, Switchgrass And Miscanthus RhizosphereARGRDFGDFVRLALNAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0207684_1167668813300025910Corn, Switchgrass And Miscanthus RhizosphereDFGDFVRIALNAAADQIEPCTDGPEGLVPIRARILARAGVPWPQAFAMSRYWLGPK
Ga0207664_1178720223300025929Agricultural SoilALNAAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0207665_1039304513300025939Corn, Switchgrass And Miscanthus RhizosphereMSPPVFAELLRRALHAAADQVEPCTDGLAPIRARILARAGVPWPQALAISRYWLGPK
Ga0209801_130806513300026326SoilLALNAAAEQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0257159_105543723300026494SoilAADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0209218_114214013300027505Forest SoilVRYALQAAADQVEPHADALVPIRARILAGAGIPWPQAFAISLNWIHDA
Ga0209073_1023733223300027765Agricultural SoilALNAAADQVEPCADGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0209283_1030501023300027875Vadose Zone SoilADFVRQAMHSAVDQVEPRADGLVSIRARILAGSGVPWPQALALSLYWLGPKHPAGRGGVAKG
Ga0137415_1065238623300028536Vadose Zone SoilRDFGEFVRLALNAAADQIEPCTDGPEGLIPIRARILARAGVPWPQAFAMSRYWLGPK
Ga0307323_1028321013300028787SoilVRLALNTAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0307305_1009777213300028807SoilLNTATDQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0307312_1117504223300028828SoilLNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0222749_1026303823300029636SoilADQVEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0310038_1041127413300030707Peatlands SoilVEPRGDGLAPIRAKILAAAGVPWAKALAISRYWLGPK
Ga0318516_1037601423300031543SoilFGDFVRLALHAAADQVEPCVDGPEGLVPIRARILARSGVPWPQAFALSRYWLGPK
Ga0318516_1060225413300031543SoilQVEPCTDGPEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0318573_1003031533300031564SoilSPSNPPTFAELVRLALHSAADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK
Ga0318492_1065527713300031748SoilDQVEPGSDGLVPIRARILAAAGVPWPQAFALSRYWLGP
Ga0318509_1049548013300031768SoilALQSAADQVEPCTDGPEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0318521_1052409913300031770SoilVEPCTDGPEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0318546_1058275713300031771SoilADQVEPCVDGPEGLVPIRARILARSGVPWPQAFALSRYWLGPK
Ga0318566_1032397323300031779SoilHAAADQVEPCTDGLIPIRARILARAGVPWPQAFAMSRYWLGPK
Ga0318566_1052126323300031779SoilRARLALHAAADQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0318552_1033720713300031782SoilVEPCVDGPEGLVPIRARILARSGVPWPQAFALSRYWLGPK
Ga0318499_1036735513300031832SoilQVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK
Ga0318511_1051320323300031845SoilRLALQSAADQVEPCTDGPEGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0306923_1113150513300031910SoilIEPCVDGPDGLVPIRARILARSGVPWPQAFALSRYWLGPK
Ga0310913_1109717023300031945SoilFGDFVRLALHAAADQVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK
Ga0310909_1036963613300031947SoilRDFGDFVRLALHAAADQVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK
Ga0310909_1047243323300031947SoilCDPFSFGDFVRLALHSAADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK
Ga0318530_1040315213300031959SoilVRLALHAAADQVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK
Ga0306922_1019938833300032001SoilSFGDFVRLALHSAADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK
Ga0306922_1185262723300032001SoilVSPSNPPTFAELVRLALHSAADQVEPGSDGLVPIRARILAAAGVPWPQAFALSRYWLGP
Ga0318563_1064437423300032009SoilARLALHAAADQVEPCTDGLVPIRARILARAGVPWPQAFAISRYWLGPK
Ga0318570_1026865513300032054SoilALHAAADQVEPCTDGLVPIRARILARAGVPWPRAFAMSRYWLGPK
Ga0318513_1027860213300032065SoilVRLALHAAAEQVEPCVDGPEGLVPIRARILARAGVPWPQAFALSRYWLGPK
Ga0318514_1018894923300032066SoilAARGRDFGDFVRLALHAAADQVEPCVDGPEGLVPIRARILARSGVPWPQAFALSRYWLGP
Ga0318524_1001801313300032067SoilMHSAADQVEPCADGLVSIRARILAGAGVPWPQALALSVYWLGPKRRREPGAGA
Ga0318540_1006061333300032094SoilADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK
Ga0307470_1015648713300032174Hardwood Forest SoilQIEPCTDGLIPIRARILARAGVPWPQAFAISRYWLGPK
Ga0306920_10099077613300032261SoilVDGPEGLVPIRARILARSGVPWPQAFALSRYWLGPK
Ga0335082_1147318623300032782SoilGPEPVSPAAFAEFLRRALNAAADQVEPCTDGLAPIRARILARAGVPWPQALAVSRYWLGP
Ga0335080_1110345813300032828SoilRGRDFADFVRLALHAAADQIEPRADGPEGLVPIRARILARSGVPWPQAFAMSRYWLGPK
Ga0318519_1059868533300033290SoilDPFSFGDFVRLALHSAADQVEPCTDGLIPIRARILARAGVPWRQAFAMSRYWLGPK
Ga0310811_1059446813300033475SoilGRDFGEFVRLALNAAADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK
Ga0373958_0127454_498_6203300034819Rhizosphere SoilADQIEPCTDGLIPIRARILARAGVPWPQAFALSRYWLGPK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.