| Basic Information | |
|---|---|
| Family ID | F088857 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQ |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.80 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.50 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.578 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.027 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.532 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.94% β-sheet: 0.00% Coil/Unstructured: 76.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00155 | Aminotran_1_2 | 40.37 |
| PF00106 | adh_short | 1.83 |
| PF07883 | Cupin_2 | 1.83 |
| PF13404 | HTH_AsnC-type | 0.92 |
| PF16537 | T2SSB | 0.92 |
| PF01904 | DUF72 | 0.92 |
| PF00753 | Lactamase_B | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.58 % |
| Unclassified | root | N/A | 6.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0287511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100617184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300004633|Ga0066395_10385800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 786 | Open in IMG/M |
| 3300005332|Ga0066388_102863884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 881 | Open in IMG/M |
| 3300005434|Ga0070709_10793012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300005435|Ga0070714_101666556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300005439|Ga0070711_100948558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300005471|Ga0070698_101173665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 717 | Open in IMG/M |
| 3300005530|Ga0070679_100630354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300005712|Ga0070764_10742930 | Not Available | 607 | Open in IMG/M |
| 3300005713|Ga0066905_101596735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300005764|Ga0066903_103158636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300006575|Ga0074053_11926395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1549 | Open in IMG/M |
| 3300006579|Ga0074054_11955949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1603 | Open in IMG/M |
| 3300006852|Ga0075433_10153219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 2050 | Open in IMG/M |
| 3300006954|Ga0079219_11978033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300009143|Ga0099792_10964669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300010043|Ga0126380_10498740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300010047|Ga0126382_11015308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300010047|Ga0126382_11926194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300010359|Ga0126376_10998491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300010360|Ga0126372_10050310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2816 | Open in IMG/M |
| 3300012176|Ga0153952_1129253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300012199|Ga0137383_11097636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300012201|Ga0137365_11185695 | Not Available | 547 | Open in IMG/M |
| 3300012206|Ga0137380_11097701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300012207|Ga0137381_10593749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300012356|Ga0137371_10178710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1663 | Open in IMG/M |
| 3300012359|Ga0137385_10752037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300012359|Ga0137385_10816957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300013105|Ga0157369_10196283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2119 | Open in IMG/M |
| 3300013297|Ga0157378_10771006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300015242|Ga0137412_10801886 | Not Available | 691 | Open in IMG/M |
| 3300015245|Ga0137409_10697167 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300015374|Ga0132255_100881320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
| 3300017944|Ga0187786_10050632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
| 3300018012|Ga0187810_10224716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300020581|Ga0210399_10315863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
| 3300020582|Ga0210395_10120989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1944 | Open in IMG/M |
| 3300020583|Ga0210401_10704494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300021088|Ga0210404_10915012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300021178|Ga0210408_10144780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1881 | Open in IMG/M |
| 3300021180|Ga0210396_11493853 | Not Available | 555 | Open in IMG/M |
| 3300021404|Ga0210389_10128053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1964 | Open in IMG/M |
| 3300021405|Ga0210387_10987649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300021405|Ga0210387_11063356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300021406|Ga0210386_10767687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300024179|Ga0247695_1029704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300024245|Ga0247677_1004640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1826 | Open in IMG/M |
| 3300024288|Ga0179589_10017827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2289 | Open in IMG/M |
| 3300025901|Ga0207688_10999001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025906|Ga0207699_10965237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300025910|Ga0207684_10371455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300025921|Ga0207652_10232502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1661 | Open in IMG/M |
| 3300025921|Ga0207652_10972520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300025922|Ga0207646_10171500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1959 | Open in IMG/M |
| 3300026067|Ga0207678_11721642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300026217|Ga0209871_1056463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300026306|Ga0209468_1098991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300026343|Ga0209159_1163105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 835 | Open in IMG/M |
| 3300026557|Ga0179587_10698217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300027692|Ga0209530_1166001 | Not Available | 616 | Open in IMG/M |
| 3300027846|Ga0209180_10720688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300027867|Ga0209167_10667232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300027884|Ga0209275_10372892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300027908|Ga0209006_10387454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1179 | Open in IMG/M |
| 3300027908|Ga0209006_10427190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300028536|Ga0137415_11309386 | Not Available | 543 | Open in IMG/M |
| 3300028906|Ga0308309_10570733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300030013|Ga0302178_10339211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300030618|Ga0311354_10624799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300030979|Ga0068589_11285515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300031234|Ga0302325_11470936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300031469|Ga0170819_14463625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300031549|Ga0318571_10343824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031564|Ga0318573_10632817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300031572|Ga0318515_10067629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1830 | Open in IMG/M |
| 3300031640|Ga0318555_10406509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
| 3300031680|Ga0318574_10550557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300031681|Ga0318572_10301366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300031681|Ga0318572_10682469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300031715|Ga0307476_10637047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300031719|Ga0306917_11035895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300031744|Ga0306918_10252387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300031764|Ga0318535_10173712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300031765|Ga0318554_10348714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300031779|Ga0318566_10514816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300031781|Ga0318547_10646615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300031796|Ga0318576_10283305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300031820|Ga0307473_10503499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300031879|Ga0306919_10804565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300031910|Ga0306923_10194351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2319 | Open in IMG/M |
| 3300031946|Ga0310910_10357104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
| 3300031981|Ga0318531_10329702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300032001|Ga0306922_10918444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300032008|Ga0318562_10608205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300032035|Ga0310911_10676975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300032052|Ga0318506_10407429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300032063|Ga0318504_10609806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300032064|Ga0318510_10296675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300032064|Ga0318510_10405619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300032065|Ga0318513_10297718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300032180|Ga0307471_100955488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
| 3300032895|Ga0335074_10239984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 2148 | Open in IMG/M |
| 3300032896|Ga0335075_11026882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300033158|Ga0335077_11000371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300033289|Ga0310914_10636216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300033290|Ga0318519_10446823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300033548|Ga0316216_1013390 | Not Available | 649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.92% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_02875112 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTTSSAPLANLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARAM |
| JGIcombinedJ26739_1006171842 | 3300002245 | Forest Soil | MTIDPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADSRQSQRALARQ |
| Ga0066395_103858002 | 3300004633 | Tropical Forest Soil | MTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQRA |
| Ga0066388_1028638841 | 3300005332 | Tropical Forest Soil | MTTSSAPLAKLTEVSTQPTPKADVDELDLALLRVLAVDARQSQRALARA |
| Ga0070709_107930122 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAISAPLAKLTEVSAPATPPAEVDELDLALLRSLADNARQSQR |
| Ga0070714_1016665561 | 3300005435 | Agricultural Soil | MTTSSAPLAKLTEVSAPPTPKADVDELDLALLRVLAVDARQSQ |
| Ga0070711_1009485581 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLAVDAR |
| Ga0070698_1011736652 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLAVDARQSQRALARAIE |
| Ga0070679_1006303542 | 3300005530 | Corn Rhizosphere | MTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQ |
| Ga0070764_107429302 | 3300005712 | Soil | MTINPAPLAKLAEVSPPPRPEVEVDDLDLALLRALAA |
| Ga0066905_1015967352 | 3300005713 | Tropical Forest Soil | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQR |
| Ga0066903_1031586361 | 3300005764 | Tropical Forest Soil | MTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLA |
| Ga0074053_119263952 | 3300006575 | Soil | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARAI |
| Ga0074054_119559491 | 3300006579 | Soil | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARA |
| Ga0075433_101532193 | 3300006852 | Populus Rhizosphere | MRSSSAPLAKLTEVSTPPTPKAEVDELDLALLRAL |
| Ga0079219_119780332 | 3300006954 | Agricultural Soil | MTTSSAPLAKLTEVSTQPTPKADVDELDLALLRVLAVDARQ |
| Ga0099792_109646691 | 3300009143 | Vadose Zone Soil | MATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALATDA |
| Ga0126380_104987401 | 3300010043 | Tropical Forest Soil | MASISAPLARLSEVCSTAAPRVDLDDLDLALLRALAGDARQSQRALA |
| Ga0126382_110153082 | 3300010047 | Tropical Forest Soil | MDSVSAPLARLTEVAPPAAPKVEVDDSDLALLRALAADARQSQRAL |
| Ga0126382_119261941 | 3300010047 | Tropical Forest Soil | MDAVSAPLAGLAEVTSPTSPQVDVDDLDLAMLRALARDARQSQRALARAIK |
| Ga0126376_109984912 | 3300010359 | Tropical Forest Soil | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQ |
| Ga0126372_100503101 | 3300010360 | Tropical Forest Soil | MDAVSAPLAGLAEVTSPTSPQVDVDDLDLALLRALARDARQS |
| Ga0153952_11292532 | 3300012176 | Attine Ant Fungus Gardens | LTTTSAPLARLADVASPTVQKIEVDDLDLTLLRALADDARQSQRALARA |
| Ga0137383_110976362 | 3300012199 | Vadose Zone Soil | MATVSAPLAKLAEVSSPSTPRVDVDDLDLALLCALATDARQSQRA |
| Ga0137365_111856951 | 3300012201 | Vadose Zone Soil | MDSVSAPLAGLTEVCPPAAPKVEVDDFDLALLRALASDARQ |
| Ga0137380_110977011 | 3300012206 | Vadose Zone Soil | MATVSAPLAKLAEVSSPSAPKIEVDDLDLALLRALAVD |
| Ga0137381_105937492 | 3300012207 | Vadose Zone Soil | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQS |
| Ga0137371_101787103 | 3300012356 | Vadose Zone Soil | MATSSAPLAKLTEVAAPASPKVTVDELDLALRRALATDARQSHRAL |
| Ga0137385_107520372 | 3300012359 | Vadose Zone Soil | MATVSAPLAKLAEVSSPSAPKIEVDDLDLALLRALAVDARQSQRGLARKV |
| Ga0137385_108169572 | 3300012359 | Vadose Zone Soil | MESVSAPLARLTEVTSPAAAQVDVDDFDLALLRALARDARQSQRALA |
| Ga0157369_101962831 | 3300013105 | Corn Rhizosphere | MESVSAPLAGLADVSGSPAPTAEVDESDLALLSALAEDARQSQRS |
| Ga0157378_107710062 | 3300013297 | Miscanthus Rhizosphere | MTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDAR |
| Ga0137412_108018861 | 3300015242 | Vadose Zone Soil | MTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQRALAR |
| Ga0137409_106971672 | 3300015245 | Vadose Zone Soil | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRAL |
| Ga0132255_1008813201 | 3300015374 | Arabidopsis Rhizosphere | MRSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQ |
| Ga0187786_100506321 | 3300017944 | Tropical Peatland | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALA |
| Ga0187810_102247162 | 3300018012 | Freshwater Sediment | MTINPAPLAKLAEVSRPPRPEVEVDDLDLALLRALAADSR |
| Ga0210399_103158631 | 3300020581 | Soil | VARSSGPLAGLAEVVTPTTPKVEVDDLDIALLRELAVDSR |
| Ga0210395_101209893 | 3300020582 | Soil | VTRISGPLAGLAEVATPTTPKVEVDDLDIALLRELAVDSRQSQRALA |
| Ga0210401_107044941 | 3300020583 | Soil | MTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQR |
| Ga0210404_109150122 | 3300021088 | Soil | MTTVSAPLAKLAEVSSPATPQAEVDDLDLALLRAPATDARQP |
| Ga0210408_101447803 | 3300021178 | Soil | VARSSGPLAGLAEVVTPTTPKVEVDDLDIALLRELAVDSRQSQRAL |
| Ga0210396_114938532 | 3300021180 | Soil | MAIDPAPLAKLADVSPPPRPEVEVDDLDLALQRALA |
| Ga0210389_101280533 | 3300021404 | Soil | MASISAPLAKLTEVASPSTPKAEVDELDLALLRALAADARQSL |
| Ga0210387_109876492 | 3300021405 | Soil | MTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQRA |
| Ga0210387_110633562 | 3300021405 | Soil | VARSSGPLAGLAEVVTPTTPKVEVDDLDIALLRELAVDSRQSQRA |
| Ga0210386_107676871 | 3300021406 | Soil | MTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADAR |
| Ga0247695_10297041 | 3300024179 | Soil | MTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQRALA |
| Ga0247677_10046403 | 3300024245 | Soil | MTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDA |
| Ga0179589_100178274 | 3300024288 | Vadose Zone Soil | MTIDPAPLAKLAEVSPPPRPEVEVDDLDLALLRALAADARQ |
| Ga0207688_109990011 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVNPAPLAKLAEVSPPSRPEAEVDELDLALLRALAADARQSQRALA |
| Ga0207699_109652372 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAISAPLAKLTEVSAPATPPAEVDELDLALLRSLADNA |
| Ga0207684_103714552 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVSAPLAKLAEVSSPSAPKIEVDDLDLALLRALAVDSRQSQRGL |
| Ga0207652_102325022 | 3300025921 | Corn Rhizosphere | MTVNPAPLAKLVEVSPPSTPEAEVDELDLALLRALAADARQSQRALARQ |
| Ga0207652_109725202 | 3300025921 | Corn Rhizosphere | MTSVSAPLAKLAEVTAPAVPPADLDDLDLALLRALADDARQSQRAL |
| Ga0207646_101715003 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVSAPLARLTEVSPPAAQKAEVDDFDLALLRALANDARQSQ |
| Ga0207678_117216421 | 3300026067 | Corn Rhizosphere | MTTSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQ |
| Ga0209871_10564632 | 3300026217 | Permafrost Soil | MATISAPLAKLTEVSSPPTPEAGVDDLDLALLHALAV |
| Ga0209468_10989911 | 3300026306 | Soil | MTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRAL |
| Ga0209159_11631052 | 3300026343 | Soil | MTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAV |
| Ga0179587_106982172 | 3300026557 | Vadose Zone Soil | MESVSAPLAGLAEVSAPPPPTVEVDEYDLALLRALAQDARQSQRAL |
| Ga0209530_11660012 | 3300027692 | Forest Soil | MTINPAPLAKLAEVSQPPRPEVEVDDFDLALLRALAGDAR |
| Ga0209180_107206882 | 3300027846 | Vadose Zone Soil | MATSSAPLARLTEVAAPSSPKVEVDELDLALLRALATDARQSQRALARTV |
| Ga0209167_106672321 | 3300027867 | Surface Soil | MATSSAPLANLTEVAAPTPPKVEVDELDLALLRALATDARQSQRA |
| Ga0209275_103728922 | 3300027884 | Soil | MTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALA |
| Ga0209006_103874543 | 3300027908 | Forest Soil | MTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADARQSQRAL |
| Ga0209006_104271901 | 3300027908 | Forest Soil | MTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRAL |
| Ga0137415_113093862 | 3300028536 | Vadose Zone Soil | MTINPTPLGKLAEVSQPPRPEVEVDDFDLALLRALAADARRSQRALARQ |
| Ga0308309_105707331 | 3300028906 | Soil | MTINPTPLGKLAEVSPPPRPEVEVDDFDLALLRAL |
| Ga0302178_103392111 | 3300030013 | Palsa | MTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADS |
| Ga0311354_106247992 | 3300030618 | Palsa | MTTNPTPLARLAEVSPPSRPEVEVDNLDLALLRAL |
| Ga0068589_112855151 | 3300030979 | Soil | MATVSAPLARLAEVTSAAPPKVEVDDLDLALLRALATDARQSQ |
| Ga0302325_114709362 | 3300031234 | Palsa | METAPLATLTEVTAPPVPRIEVDDLDLALLRALATDARQSQRAL |
| Ga0170819_144636252 | 3300031469 | Forest Soil | MESVSAPLAGLADVSAPPAPTVEVDESDLALLRALAE |
| Ga0318571_103438242 | 3300031549 | Soil | MATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALATDARQSQ |
| Ga0318573_106328171 | 3300031564 | Soil | MTTSSAPLAKLTEVSTPPTPKADVDELDLALLRVLADDAR |
| Ga0318515_100676291 | 3300031572 | Soil | MATSSAPLAKLAEVAAPSPPKVEVDELDLALLRAL |
| Ga0318555_104065091 | 3300031640 | Soil | MTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVL |
| Ga0318574_105505572 | 3300031680 | Soil | MATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALAT |
| Ga0318572_103013661 | 3300031681 | Soil | LTTTSAPFAHLADVTSPSTQKIEVDDLDLTLLRALAVDARQSQR |
| Ga0318572_106824691 | 3300031681 | Soil | MATSSAPLAKLTEVAAPSPPKVEVDELDLALLRALATDARQSQ |
| Ga0307476_106370472 | 3300031715 | Hardwood Forest Soil | MTINPAPLAKLAEVSPPPRPEVEVDDFDLALLRALAADSRQSQRALARQI |
| Ga0306917_110358952 | 3300031719 | Soil | MATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATDARQSQRA |
| Ga0306918_102523871 | 3300031744 | Soil | MATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATDA |
| Ga0318535_101737122 | 3300031764 | Soil | MTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVLAEDARQS |
| Ga0318554_103487141 | 3300031765 | Soil | MTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLS |
| Ga0318566_105148162 | 3300031779 | Soil | MATSSAPLAKLTEVAAPSSPKVEVDELDLALLRALATDARQSQRALA |
| Ga0318547_106466151 | 3300031781 | Soil | MTTSSAPLAKLTEVSAPPTPKADVDELDLALLRAL |
| Ga0318576_102833052 | 3300031796 | Soil | MTTSSAPLAKLTEVSAPPTPKADVDELDLALLRALAVDARQSQRA |
| Ga0307473_105034991 | 3300031820 | Hardwood Forest Soil | MTSSSAPLAKLTEVSTPPTPKAEVDELDLALLRALAVDARQSQRALARAIE |
| Ga0306919_108045652 | 3300031879 | Soil | MTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLSVDA |
| Ga0306923_101943511 | 3300031910 | Soil | MATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATD |
| Ga0310910_103571041 | 3300031946 | Soil | MTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVLAEDAR |
| Ga0318531_103297022 | 3300031981 | Soil | MATSSAPLAKLTEVAAPSPPKVEVDELDLALLRAL |
| Ga0306922_109184442 | 3300032001 | Soil | MATSSAPLAKLTEVAAPSSPKVEVDELDLALRRALATDARQSQR |
| Ga0318562_106082052 | 3300032008 | Soil | MATSSAPLAKLTEVAAPSPPKVEVDELDLALLRALATDARQ |
| Ga0310911_106769752 | 3300032035 | Soil | MATSSAPLAKLAEVAAPSPPKVEVDELDLALLRALATDARQ |
| Ga0318506_104074291 | 3300032052 | Soil | MTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLR |
| Ga0318504_106098061 | 3300032063 | Soil | MTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLSVDARQSQRA |
| Ga0318510_102966752 | 3300032064 | Soil | MTGPWQMTSSSAPLAKLTEVSAPPTPKADLDELDLALLRVLSVDARQSQRALAR |
| Ga0318510_104056191 | 3300032064 | Soil | MTTSSAPLAKLTEVSTPPTPKADVDELDLALLRVLAVDARQSQRALARAIE |
| Ga0318513_102977181 | 3300032065 | Soil | MTTSSAPLAKLTEVSAPPTPKADVDELDLALLRALAVDARQSQRALARAIE |
| Ga0307471_1009554881 | 3300032180 | Hardwood Forest Soil | MTTSSAPLAKLTDVSAPPTPKADVDELDLALLRVLAVDA |
| Ga0335074_102399841 | 3300032895 | Soil | LGNAQMTSVSTPLAKLTEVSASSTPAVEVDSLDLALLRALTSN |
| Ga0335075_110268821 | 3300032896 | Soil | MASVSAPLARLAEVTSAARPKVEVDDLDLALLHALA |
| Ga0335077_110003712 | 3300033158 | Soil | MDSVSVPRSNTANPAPLARLGEVSPPSTPTMDVDDFDLALLRALAGDARQSQRALGRK |
| Ga0310914_106362162 | 3300033289 | Soil | MTTSPAPLAKLTEVSAPPTPKADVDELDLALLRVLAE |
| Ga0318519_104468231 | 3300033290 | Soil | MATSSAPLAKLTEVAAPSPPKVEVDELDLALLRALAT |
| Ga0316216_10133902 | 3300033548 | Roots | MTINPAPLAKLAEVSPPPRPEVEVDDLDLALLRALAADARLS |
| ⦗Top⦘ |