 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F088848 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VNMMLGAARVRRERIQLADTWTFITVACFLLWTAAVLLGA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 90.83 % |
| % of genes from short scaffolds (< 2000 bps) | 89.91 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.982 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.018 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.706 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00027 | cNMP_binding | 56.88 |
| PF13545 | HTH_Crp_2 | 35.78 |
| PF07690 | MFS_1 | 3.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.98 % |
| All Organisms | root | All Organisms | 22.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030627 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030981 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_07627750 | 2124908009 | Soil | ARLNMMLGAARVRRERLHLADTWTFITVACFLAWTMAVLLGA |
| JGI12627J18819_102923732 | 3300001867 | Forest Soil | VNLLLGAVRIRCERVHLADTWTFVTAAVFGVWTALIFLS* |
| JGIcombinedJ51221_102245552 | 3300003505 | Forest Soil | NVGAWARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA* |
| Ga0062384_1010139742 | 3300004082 | Bog Forest Soil | WARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA* |
| Ga0066869_100184162 | 3300005165 | Soil | SWAQVDMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0066676_111599541 | 3300005186 | Soil | VNMMLGAARVRRERIQLADTWTFITVACFLLWTAAVLLGA* |
| Ga0070682_1004590541 | 3300005337 | Corn Rhizosphere | QVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0070706_1000369565 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DSEAAWSWARVNMMLGAARVRRERIELADTWTFITVACFLVWTAAVLLGA* |
| Ga0070706_1018851811 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DSEAAWSWARVNMMLGAARVRRERIELADTWTFITVACFLLWTAAVLVGA* |
| Ga0070761_106019581 | 3300005591 | Soil | ARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA* |
| Ga0074054_100219122 | 3300006579 | Soil | MLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0074049_123994621 | 3300006580 | Soil | AARIRRERIQSAESWTFITVACFLAWTAAVLLGA* |
| Ga0074062_100474762 | 3300006606 | Soil | VDMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0066665_102926081 | 3300006796 | Soil | NMMLGAARVRRERIQLADTWTFIAVACFLLWTATVLLGA* |
| Ga0066659_102270151 | 3300006797 | Soil | MMLGAARVRRERIQLAQTWTLITVACYLLWTVAVLLGA* |
| Ga0079221_108105391 | 3300006804 | Agricultural Soil | STPSTGDGEAAWSWAQVNMMLGAARIRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0079221_108890242 | 3300006804 | Agricultural Soil | EAAWSWAQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0075424_1021717641 | 3300006904 | Populus Rhizosphere | MLGAARVRRERIQAAETWTFITVACFLLWTATVLLGA* |
| Ga0074063_138006732 | 3300006953 | Soil | NMMLGAARVRRERLHLADTWTFITAACFLVWTAAVLFGA* |
| Ga0099794_106750661 | 3300007265 | Vadose Zone Soil | SEAAWTWTRVNLMLGAARVRRERIHLADTWTFITVACFLVWTATVLLGA* |
| Ga0066710_1018082992 | 3300009012 | Grasslands Soil | EDGAAAWSWARVNMMLGAARVRRERIQLAQTWTLITVACYLLWTAAVLLGA |
| Ga0099829_108660092 | 3300009038 | Vadose Zone Soil | DWARVNLMLSAARVRRERIHLADTWTFITVACFLILTVTVLLGA* |
| Ga0111539_131599342 | 3300009094 | Populus Rhizosphere | WSWTQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0105247_115473072 | 3300009101 | Switchgrass Rhizosphere | EAGWSWTQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0126373_107803311 | 3300010048 | Tropical Forest Soil | AEDGEGGWSWARVNMMLGAARVRRERIQLAETWTFITVACFLLWTAAVLLGA* |
| Ga0074046_107305701 | 3300010339 | Bog Forest Soil | LLSAARIRRERIHLADTWTFITVACFLAWTVAVLLGA* |
| Ga0134126_125038082 | 3300010396 | Terrestrial Soil | WTWARLNMMLGAVRVRRERLHLADTWTFITVACFLAWTMAVLLGE* |
| Ga0126352_11715672 | 3300010859 | Boreal Forest Soil | RVNLLIGSARIRRERIHLVDTWTFLTGACFLAWTMAVLLGA* |
| Ga0150983_139368432 | 3300011120 | Forest Soil | LLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLHP* |
| Ga0137389_102954731 | 3300012096 | Vadose Zone Soil | MLSAARIRRERIHLADTWTFITAACFLVWTMSVLLGA* |
| Ga0137364_107499051 | 3300012198 | Vadose Zone Soil | TAENGAAAWSWARVNMMLGAARVRRERIQRAETWTLITVACFLLWTATVLLGA* |
| Ga0137382_100920751 | 3300012200 | Vadose Zone Soil | AAWSWARVNMMLGAARVRRERIQLAQTWTFITVACYLLWTAAVLLGA* |
| Ga0137382_103983822 | 3300012200 | Vadose Zone Soil | GDSAAAWSWAHVNMMLGAARVRRERIQRAETWTLITVACFLLWTATVLLGA* |
| Ga0137380_106639871 | 3300012206 | Vadose Zone Soil | AWDWARVNLMLGAVRVRRERINQADTWALITVACFLAWTVTVLLGA* |
| Ga0157320_10010861 | 3300012481 | Arabidopsis Rhizosphere | AQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0137396_107710222 | 3300012918 | Vadose Zone Soil | GAARIRRERIQLAETWTFITVACFLLWTATVFLGA* |
| Ga0137419_106872892 | 3300012925 | Vadose Zone Soil | HVNMMLGATRVRRERIQRADTWTFITAACFLLWTAAVLLGA* |
| Ga0164305_121217041 | 3300012989 | Soil | EAAWTWARLNMMLGAVRVRRERLHLADTWTFITVACFLAWTMAVLLGA* |
| Ga0157373_104953522 | 3300013100 | Corn Rhizosphere | SRPSTGDGDAAWSWAQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0157378_104861431 | 3300013297 | Miscanthus Rhizosphere | MLGAARIRRERIQSAETWTFITVACFLLWTAAVLLGA* |
| Ga0181538_104669701 | 3300014162 | Bog | NLLLSAARIRRERIHLADTWTFITVACFLAWTVAVLLGA* |
| Ga0181525_105554412 | 3300014654 | Bog | AARIRRERIHLVDTWTFITVGCFLAWTVAVLLGA* |
| Ga0181522_108158541 | 3300014657 | Bog | GAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA* |
| Ga0182036_107573962 | 3300016270 | Soil | MLGAARVRRERIHRADTWTVATAACFLLWTAAVLLGA |
| Ga0182038_105517862 | 3300016445 | Soil | GAARVRRERIHRADTWTVATAACFLLWTAAVLLGA |
| Ga0187809_100582003 | 3300017937 | Freshwater Sediment | WSWAHVDMMLGAARVRRERIQLAETWTFITVACFLLWTATVLLGA |
| Ga0187847_107323282 | 3300017948 | Peatland | DAWNWARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVAVLLGA |
| Ga0187783_107543552 | 3300017970 | Tropical Peatland | VNLLLGAVRIRRERLHRADTWTFITAACFLAWTVAVLLGA |
| Ga0187883_100855001 | 3300018037 | Peatland | RVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVAVLLGA |
| Ga0187890_103977132 | 3300018044 | Peatland | WARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTAAVLLGA |
| Ga0187859_101306301 | 3300018047 | Peatland | LLLGAARIRRERIHLVDTWTFITAACFLAWTVAVLLGA |
| Ga0187772_106089292 | 3300018085 | Tropical Peatland | RVNLMLGAARVRRERLHIAGTWTFITVACFLLWTVAVLLGA |
| Ga0066669_101371423 | 3300018482 | Grasslands Soil | SIGGSEAAWSWAQVNMMLGAARVRRERIQLAQTWTLITVACYLLWTAAVLLGA |
| Ga0182031_15225401 | 3300019787 | Bog | VNLLLGAARIRRERIHLMDTWTFVTGACFLAWTLAVLLGA |
| Ga0210388_100588461 | 3300021181 | Soil | VNLMLGAARIRRERLHRADTWAIITVACFLAWTVAIFLGA |
| Ga0210385_102303433 | 3300021402 | Soil | AWNWTRVNLMLGAARIRRERLHRADTWAIITVACFLAWTVAIFLGA |
| Ga0210387_113096182 | 3300021405 | Soil | GNWTRVNRMLGAARIRRERLHRADTWAIITVACFLAWTVAIFLGA |
| Ga0210383_108046062 | 3300021407 | Soil | LLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA |
| Ga0210392_103065783 | 3300021475 | Soil | KAGWSWAQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA |
| Ga0210402_103262881 | 3300021478 | Soil | SWARVNMMLGAARVRRERIQLAQTWTFITVACFLLWTAAVLVGA |
| Ga0126371_124736242 | 3300021560 | Tropical Forest Soil | AGDSEAAWSWTRVSMMLGAARVRRERIQLAGTWTFITVACFLLWTAAILLGA |
| Ga0126371_133769521 | 3300021560 | Tropical Forest Soil | SEAAWSWAQVNMMLGATRVRRERIHSAETWTFITVACFLLWTAAVLLGA |
| Ga0224572_10338871 | 3300024225 | Rhizosphere | ARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA |
| Ga0247676_10212571 | 3300024249 | Soil | TPSSGDGEAAWSWAQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA |
| Ga0247681_10584392 | 3300024310 | Soil | GDSEAGWSWTQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA |
| Ga0247666_11172382 | 3300024323 | Soil | ADSEAGWSWTQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA |
| Ga0207707_107078491 | 3300025912 | Corn Rhizosphere | IGDGEAGWSWTQVNMMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA |
| Ga0257153_10649152 | 3300026490 | Soil | WSWAHVNMMLGAARIRRERIQLAETWTFITVACFLLWTATVLLGA |
| Ga0179587_106017591 | 3300026557 | Vadose Zone Soil | MMLGATRVRRERIQRADTWTFITAACFLLWTAAVLLGA |
| Ga0209115_10644913 | 3300027567 | Forest Soil | GAWARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLAA |
| Ga0209180_104264791 | 3300027846 | Vadose Zone Soil | DWARVNLMLSAARVRRERIHLADTWTFITVACFLILTVTVLLGA |
| Ga0209380_104713491 | 3300027889 | Soil | NLLLGAARIRRERIHLADTWTYVTVAVFLVWTAAIFLGL |
| Ga0302231_100363521 | 3300028775 | Palsa | PAEENADAWARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTATVLLGA |
| Ga0302226_101235053 | 3300028801 | Palsa | LLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA |
| Ga0222749_106451831 | 3300029636 | Soil | QVDMMLGAARVRRERIQLADTWTFITVACFLLWTATVLLGA |
| Ga0302183_102888061 | 3300030509 | Palsa | SEENVGAWARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTVTVLLGA |
| Ga0302183_103782431 | 3300030509 | Palsa | PAEENADAWARVSLLLGAARIRRERIHLVDTWTFITAACFLAWTATVLLGA |
| Ga0311354_103634523 | 3300030618 | Palsa | EENADAWARVNLLLGAARIRRERIHLVDTWTFITAACFLAWTATVLLGA |
| Ga0210269_100942951 | 3300030627 | Soil | LLGAARIRGERIHLADTWTLVTAACFLTWTAALFLGR |
| Ga0265462_126131722 | 3300030738 | Soil | GAARIRRERIHLVDTWTLATGACFLAWTMAILLGA |
| Ga0265461_128231282 | 3300030743 | Soil | SEENADAWNWARVNLLLGAARIRRERIQLVDTWTFITAACFLAWTAAVLLGA |
| Ga0102770_111831822 | 3300030981 | Soil | DGEAAWDWAHVNLMLGAVRHRRERIQLADTWTFITVACFLAWTVTVLLGA |
| Ga0302324_1010076183 | 3300031236 | Palsa | LLGAARIRRERIHLVDTWTFITAACFLAWTAAVLLGA |
| Ga0318572_105244372 | 3300031681 | Soil | LLGAARMNRSRIQLADTWTYITAAVFVVWTATVLVGL |
| Ga0310686_1027504932 | 3300031708 | Soil | LMLGAARVRRERLHRADTWTIITVTCFLAWTVAILLGA |
| Ga0306918_108625752 | 3300031744 | Soil | ARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318535_103886182 | 3300031764 | Soil | LSTPAGGDREAAWSWARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318554_101919463 | 3300031765 | Soil | AWSWARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318521_107460291 | 3300031770 | Soil | AAWSWARVDMMLGAARVRRERIHLAGTWTFITVACFLLWTAAVLVGA |
| Ga0318568_104209172 | 3300031819 | Soil | VNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318567_108441842 | 3300031821 | Soil | TRVTLMLGAARVRRERLHRADTWTFLTVACFLLWTVAVLLGA |
| Ga0307478_113725751 | 3300031823 | Hardwood Forest Soil | SAAWSWGHVNMMIGAARVRRERIQLAETWTFITVACFLLWTAAVLVGA |
| Ga0318517_100515651 | 3300031835 | Soil | GGDREAAWSWARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318527_100752901 | 3300031859 | Soil | AAWSWARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318522_101423852 | 3300031894 | Soil | WSWARVDMMLGAARVRRERIHLAGTWTFITVACFLLWTAAVLLGA |
| Ga0306921_110107492 | 3300031912 | Soil | DMMLGAARVRRERIHLAGTWTFITVACFLLWTAAVLVGA |
| Ga0308175_1007328542 | 3300031938 | Soil | NLMLGAVRVRRERIQLANTWAFITVACFLAWTAMVLLGA |
| Ga0306926_117991091 | 3300031954 | Soil | PRRASCSPAAWSWARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0318505_104406942 | 3300032060 | Soil | DAAWSWARVDMMLGAARVRRERIHLAGTWTFITVACFLLWTAAVLVGA |
| Ga0318524_101979322 | 3300032067 | Soil | SWARVNMMLGAARVRRERIQRAETWTFITVACFLLWTAAVLLGA |
| Ga0311301_107265351 | 3300032160 | Peatlands Soil | SEAAWNWTRVNLMLGAARIRRERLHLADTWTFITVACFLAWTVAVLLGA |
| Ga0307470_111252882 | 3300032174 | Hardwood Forest Soil | MLGAARVRRERIQLAETWTFITVACFLLWTATVLLGA |
| Ga0307472_1001122651 | 3300032205 | Hardwood Forest Soil | NLMLGAARVRRERIQSAETWTFITVACFLLWTAAVLLGA |
| Ga0335080_104288311 | 3300032828 | Soil | MLGAARVRRERIHLAGTWTFITVACFLLWTTALLLGA |
| Ga0335081_124118051 | 3300032892 | Soil | LGAARIRRERTHLADTWTFITVACFLIWTVTVLLGA |
| Ga0335083_104875031 | 3300032954 | Soil | VNMMLSAARVRRERIHRAGTWTFITVACFLLWTAAVLLGA |
| Ga0335077_108400741 | 3300033158 | Soil | QVNMMLGAARVRRERIQSAESWTFITVACFLLWTAAVLLGA |
| Ga0310811_106472082 | 3300033475 | Soil | PSIGDGEAAWSWAQVNMMLGAARIRRERIQSAGTWTFITVACFLLWTAAVLLGA |
| Ga0334804_064046_3_125 | 3300033818 | Soil | VNLLLGAARIRRERVHLADTWTFITAGCFLAWTLAVLLGA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |