| Basic Information | |
|---|---|
| Family ID | F088838 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TLGALARAGTRVDAVDLRYRNGFAARIPGFREKNAKPAA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 88.99 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.633 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.028 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.615 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 8.96% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF02491 | SHS2_FTSA | 51.38 |
| PF14450 | FtsA | 38.53 |
| PF12327 | FtsZ_C | 3.67 |
| PF00091 | Tubulin | 1.83 |
| PF01548 | DEDD_Tnp_IS110 | 0.92 |
| PF06723 | MreB_Mbl | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.92 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.73 % |
| Unclassified | root | N/A | 19.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004156|Ga0062589_100423434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1091 | Open in IMG/M |
| 3300004479|Ga0062595_102004514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300005333|Ga0070677_10243037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 890 | Open in IMG/M |
| 3300005435|Ga0070714_102387880 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 514 | Open in IMG/M |
| 3300005438|Ga0070701_11062482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 568 | Open in IMG/M |
| 3300005439|Ga0070711_100610772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 911 | Open in IMG/M |
| 3300005459|Ga0068867_100474042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 1071 | Open in IMG/M |
| 3300005561|Ga0066699_10998346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
| 3300005616|Ga0068852_101283369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 754 | Open in IMG/M |
| 3300006034|Ga0066656_10687873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 658 | Open in IMG/M |
| 3300006606|Ga0074062_12737139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300006871|Ga0075434_102063590 | Not Available | 575 | Open in IMG/M |
| 3300006903|Ga0075426_10114376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1937 | Open in IMG/M |
| 3300006904|Ga0075424_100431706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1405 | Open in IMG/M |
| 3300009101|Ga0105247_10891965 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 686 | Open in IMG/M |
| 3300009131|Ga0115027_10157050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1400 | Open in IMG/M |
| 3300009147|Ga0114129_10486100 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300009688|Ga0116176_10639826 | Not Available | 514 | Open in IMG/M |
| 3300009804|Ga0105063_1092194 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010359|Ga0126376_10853107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 895 | Open in IMG/M |
| 3300010362|Ga0126377_12668824 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010373|Ga0134128_12217777 | Not Available | 605 | Open in IMG/M |
| 3300010400|Ga0134122_12347846 | Not Available | 580 | Open in IMG/M |
| 3300011421|Ga0137462_1070500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
| 3300012210|Ga0137378_11804133 | Not Available | 515 | Open in IMG/M |
| 3300012361|Ga0137360_10564427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 973 | Open in IMG/M |
| 3300012486|Ga0157331_1010730 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012923|Ga0137359_10042582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3935 | Open in IMG/M |
| 3300012929|Ga0137404_11067840 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 740 | Open in IMG/M |
| 3300012989|Ga0164305_10734128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 811 | Open in IMG/M |
| 3300013104|Ga0157370_11959825 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300013296|Ga0157374_12682915 | Not Available | 526 | Open in IMG/M |
| 3300013307|Ga0157372_13468178 | Not Available | 501 | Open in IMG/M |
| 3300013763|Ga0120179_1059036 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300013769|Ga0119887_1013751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2498 | Open in IMG/M |
| 3300014166|Ga0134079_10634954 | Not Available | 536 | Open in IMG/M |
| 3300014166|Ga0134079_10750608 | Not Available | 503 | Open in IMG/M |
| 3300014296|Ga0075344_1153300 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 512 | Open in IMG/M |
| 3300014325|Ga0163163_12873352 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300015158|Ga0167622_1042380 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 857 | Open in IMG/M |
| 3300015257|Ga0180067_1159759 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 516 | Open in IMG/M |
| 3300015372|Ga0132256_102592129 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300015373|Ga0132257_101609731 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 831 | Open in IMG/M |
| 3300017947|Ga0187785_10705626 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018063|Ga0184637_10609591 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018071|Ga0184618_10319582 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300018469|Ga0190270_12811318 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300018469|Ga0190270_13317785 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018476|Ga0190274_13557987 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018481|Ga0190271_12117484 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300019888|Ga0193751_1222951 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021082|Ga0210380_10389905 | Not Available | 637 | Open in IMG/M |
| 3300021363|Ga0193699_10254107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 732 | Open in IMG/M |
| 3300021413|Ga0193750_1009375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2493 | Open in IMG/M |
| 3300022534|Ga0224452_1281591 | Not Available | 508 | Open in IMG/M |
| 3300023069|Ga0247751_1055487 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 670 | Open in IMG/M |
| 3300025913|Ga0207695_10046481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4602 | Open in IMG/M |
| 3300025916|Ga0207663_10656551 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 828 | Open in IMG/M |
| 3300025917|Ga0207660_11675039 | Not Available | 512 | Open in IMG/M |
| 3300025927|Ga0207687_11206653 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025932|Ga0207690_11160438 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300025942|Ga0207689_11044905 | Not Available | 689 | Open in IMG/M |
| 3300025949|Ga0207667_10538782 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1181 | Open in IMG/M |
| 3300025981|Ga0207640_12036615 | Not Available | 520 | Open in IMG/M |
| 3300025986|Ga0207658_10463981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1123 | Open in IMG/M |
| 3300026023|Ga0207677_10113194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2025 | Open in IMG/M |
| 3300026088|Ga0207641_10522020 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1155 | Open in IMG/M |
| 3300026476|Ga0256808_1047369 | Not Available | 624 | Open in IMG/M |
| 3300026501|Ga0256806_1001945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2736 | Open in IMG/M |
| 3300026542|Ga0209805_1078097 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1601 | Open in IMG/M |
| 3300026550|Ga0209474_10770927 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027360|Ga0209969_1050187 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 654 | Open in IMG/M |
| 3300027682|Ga0209971_1021214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1545 | Open in IMG/M |
| 3300027842|Ga0209580_10232829 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 915 | Open in IMG/M |
| 3300027871|Ga0209397_10028212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1870 | Open in IMG/M |
| 3300027876|Ga0209974_10023332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2047 | Open in IMG/M |
| 3300027915|Ga0209069_10362456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter | 785 | Open in IMG/M |
| 3300028379|Ga0268266_10572103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1084 | Open in IMG/M |
| 3300028589|Ga0247818_10251573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1168 | Open in IMG/M |
| 3300030000|Ga0311337_11172700 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 671 | Open in IMG/M |
| 3300030003|Ga0302172_10054027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1195 | Open in IMG/M |
| 3300030019|Ga0311348_10330120 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1137 | Open in IMG/M |
| 3300030114|Ga0311333_10052370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica | 2927 | Open in IMG/M |
| 3300030114|Ga0311333_11543177 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300030838|Ga0311335_10047937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica | 2660 | Open in IMG/M |
| 3300031170|Ga0307498_10399620 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031231|Ga0170824_116607361 | Not Available | 556 | Open in IMG/M |
| 3300031736|Ga0318501_10466898 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 686 | Open in IMG/M |
| 3300031765|Ga0318554_10607193 | Not Available | 616 | Open in IMG/M |
| 3300031805|Ga0318497_10422156 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 746 | Open in IMG/M |
| 3300031824|Ga0307413_10067821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2232 | Open in IMG/M |
| 3300031890|Ga0306925_10553087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1220 | Open in IMG/M |
| 3300031902|Ga0302322_101841991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 742 | Open in IMG/M |
| 3300031938|Ga0308175_101032698 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 909 | Open in IMG/M |
| 3300031941|Ga0310912_10055425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2802 | Open in IMG/M |
| 3300031943|Ga0310885_10007309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3636 | Open in IMG/M |
| 3300032008|Ga0318562_10072975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1916 | Open in IMG/M |
| 3300032008|Ga0318562_10361912 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 843 | Open in IMG/M |
| 3300032017|Ga0310899_10687029 | Not Available | 519 | Open in IMG/M |
| 3300032054|Ga0318570_10204992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 891 | Open in IMG/M |
| 3300032068|Ga0318553_10167640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1141 | Open in IMG/M |
| 3300032397|Ga0315287_11087719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 926 | Open in IMG/M |
| 3300032421|Ga0310812_10233820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
| 3300033416|Ga0316622_102952566 | Not Available | 542 | Open in IMG/M |
| 3300033485|Ga0316626_10487681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1046 | Open in IMG/M |
| 3300034129|Ga0370493_0185788 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 690 | Open in IMG/M |
| 3300034129|Ga0370493_0309891 | Not Available | 543 | Open in IMG/M |
| 3300034281|Ga0370481_0106349 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 945 | Open in IMG/M |
| 3300034354|Ga0364943_0381747 | Not Available | 542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.34% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.83% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.92% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.92% |
| Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013769 | Sewage treatment plant microbial communities from Vermont, USA - Sand_B | Engineered | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026476 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6 | Environmental | Open in IMG/M |
| 3300026501 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4 | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062589_1004234342 | 3300004156 | Soil | FVAVYERTIGTLARAGTRIEHVDLRYRNGFAARVPGFRERVRKKT* |
| Ga0062595_1020045142 | 3300004479 | Soil | AHDRTIGALARAGRHIERVDLRYRNGFAARVPGFREKPVRKS* |
| Ga0070677_102430371 | 3300005333 | Miscanthus Rhizosphere | GRTIGALARSGTRVAEIDLRYRNGFAARVPGFREKAPRRVETKD* |
| Ga0070714_1023878802 | 3300005435 | Agricultural Soil | RTVGALARAGTKVEQVDLRYRNGFSARVPAFRERPQKKAA* |
| Ga0070701_110624822 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LGALARVGTKVEVVDLRYRNGFAARVPAFREKAATRTGA* |
| Ga0070711_1006107722 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | KTVGALARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA* |
| Ga0068867_1004740422 | 3300005459 | Miscanthus Rhizosphere | QTIGALARGGTRVETVDLRYRNGYAVRVPAFREKNLKPAA* |
| Ga0066699_109983461 | 3300005561 | Soil | TVGALNRAGTRVDYVDLRYRNGFAVRVPGFTERSPRRSG* |
| Ga0068852_1012833692 | 3300005616 | Corn Rhizosphere | HGRTLGALARAGTRIEAVDLRYRNGFAARIPGFREKSAKPAAGTT* |
| Ga0066656_106878731 | 3300006034 | Soil | VGALNRGGTRVDYVDLRYRNGFAVRVPGFTERSPRKAG* |
| Ga0074062_127371391 | 3300006606 | Soil | TVGALARAGTRIDRVDLRYRNGFAARVPGLPELPARKTTG* |
| Ga0075434_1020635902 | 3300006871 | Populus Rhizosphere | AVYGRTLATLARAGTRVDRVDLRYRNGFAAHVPEFHERPAKKARAA* |
| Ga0075426_101143763 | 3300006903 | Populus Rhizosphere | LATLARAGTRVDRVDLRYRNGFAAHVPEFHERPAKKARAV* |
| Ga0075424_1004317062 | 3300006904 | Populus Rhizosphere | IGALAQVGRHIEQVDLRYRNGFAVRVPGFREKPVKKS* |
| Ga0105247_108919652 | 3300009101 | Switchgrass Rhizosphere | FVSAHRQTIGALSRAGTKVDVVDLRYRNGFAVRVPAFREKNAKPA* |
| Ga0115027_101570502 | 3300009131 | Wetland | TIGALARQGTRVDHVDLRYRNGFAARVPGLREAPAKSGA* |
| Ga0114129_104861003 | 3300009147 | Populus Rhizosphere | RTIGALARAGRWVEQVDLRYRNGFAARVPGFREKPAKKS* |
| Ga0116176_106398262 | 3300009688 | Anaerobic Digestor Sludge | LARSGTRVGEVDLRYRNGFAARVPGFREKPAKRPL* |
| Ga0105063_10921941 | 3300009804 | Groundwater Sand | TIGALARAGRWVEQVDLRYRNGFAARVPGFREKPAKKS* |
| Ga0126376_108531072 | 3300010359 | Tropical Forest Soil | RTLGALARAGTRVEYVDLRYRNGFAVRIPGFVERTPKRGG* |
| Ga0126377_126688241 | 3300010362 | Tropical Forest Soil | SRFVTYYAKTIGALARAGTRVEYADLRYRNGFAVRVPAFVEKSTKKAS* |
| Ga0134128_122177772 | 3300010373 | Terrestrial Soil | YGRTLGVLARTGTRVERVDLRYRNGFAAQMPGFREKPARKVS* |
| Ga0134122_123478461 | 3300010400 | Terrestrial Soil | TRSGVEIEHVDLRYRNGFAARVPGFKERPPKKTG* |
| Ga0137462_10705002 | 3300011421 | Soil | LDALARAGTRVAHVDLRYRNGFAARVPGFQERAPKKKAGA* |
| Ga0137378_118041332 | 3300012210 | Vadose Zone Soil | VGALNHGGTRVDSVDLRYRNGFAVRVPGFTERSPRKAG* |
| Ga0137360_105644272 | 3300012361 | Vadose Zone Soil | GALARAGTRVEYVDLRYRNGFAARVPEFKERAVKKAA* |
| Ga0157331_10107301 | 3300012486 | Soil | ARTVGALARAGTRVEYADLRYRNGFAARIPLFKERAAKKAA* |
| Ga0137359_100425825 | 3300012923 | Vadose Zone Soil | YYAKTVGALARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA* |
| Ga0137404_110678401 | 3300012929 | Vadose Zone Soil | YHARTVGALNHGGTRVDYVDLRYRNGFAVRVPGFTERSPRKAG* |
| Ga0164305_107341282 | 3300012989 | Soil | VGALAHAGTHVDHVDLRYRNSFAARVPGFREKTARRIS* |
| Ga0157370_119598252 | 3300013104 | Corn Rhizosphere | GVLAHAGTHVDHVDLRYRNGFAARMPNFREKPAHKVS* |
| Ga0157374_126829152 | 3300013296 | Miscanthus Rhizosphere | AHAGTHVDHVDLRYRNGFAARMPNFREKPAHKVS* |
| Ga0157372_134681781 | 3300013307 | Corn Rhizosphere | VLARTGKHVDHVDLRYRNGFAARMPGFREKTPRKVS* |
| Ga0120179_10590362 | 3300013763 | Permafrost | ARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA* |
| Ga0119887_10137511 | 3300013769 | Sewage Treatment Plant | TLGALARAGTRVDAVDLRYRNGFAARIPGFREKNAKPAA* |
| Ga0134079_106349542 | 3300014166 | Grasslands Soil | FVSYYARTVGALARAGTRVEYVDLRYRNGFAARVPEFKERAVKKAA* |
| Ga0134079_107506081 | 3300014166 | Grasslands Soil | RYHTRTVGALNRAGTRVDYVDLRYRNGFAVRVPGFTDRSPRKAG* |
| Ga0075344_11533002 | 3300014296 | Natural And Restored Wetlands | FVAAHGRTLGALARAGTRVDAVDLRYRNGFAARVPAFREKTMKPGA* |
| Ga0163163_128733521 | 3300014325 | Switchgrass Rhizosphere | IGALSRAGTKIDVVDLRYRNGFAVRVPNFREKNTKPSA* |
| Ga0167622_10423801 | 3300015158 | Glacier Forefield Soil | ARTIARLERSGTRVEYVDLRYSNGFAVRVPGFKERAPKKLG* |
| Ga0180067_11597592 | 3300015257 | Soil | YERTIVALARAGTRIEHVDLRYRNGFAARVPGFQERAPKKKGTGKA* |
| Ga0132256_1025921291 | 3300015372 | Arabidopsis Rhizosphere | TIGALARGGTRVETVDLRYRNGYAVRVPAFREKNLTPRA* |
| Ga0132257_1016097312 | 3300015373 | Arabidopsis Rhizosphere | GRAGTVVAQVDLRYRNGFAARVPGFRERPAKKTA* |
| Ga0187785_107056261 | 3300017947 | Tropical Peatland | TLGVLARAGTRVDRVDLRYHSGFAVHVPGFRERAKKGTA |
| Ga0184637_106095911 | 3300018063 | Groundwater Sediment | RTLGALARAGTRIDTVDLRYRNGFAARVPGFREKSAKPAAGTT |
| Ga0184618_103195822 | 3300018071 | Groundwater Sediment | VGALARAGTRVEYADLRYRNGFAARVPGFKERAMKKAA |
| Ga0190270_128113182 | 3300018469 | Soil | RAGTRIDAVDLRYRNGFAARVPGFREMGGKPAAGKT |
| Ga0190270_133177851 | 3300018469 | Soil | HGRTLGALERAGTKVDAVDLRYRNGFAARVPAFREKGAKPSA |
| Ga0190274_135579872 | 3300018476 | Soil | FVAVHDRTIGALARSGRPIGQVDLRYRNGFAVRVPGFREKPARKS |
| Ga0190271_121174841 | 3300018481 | Soil | TAAYARTVAALSRQGTRIEYVDLRYRNGFAARLPGFREGAKKPGT |
| Ga0193751_12229511 | 3300019888 | Soil | ARTVGALARAGTRVEYADLRYRNGFAARVPGFKERAMKKAA |
| Ga0210380_103899052 | 3300021082 | Groundwater Sediment | VLNRGGTRIDHVDLRYRTGFAARVPGFKERPQKRTT |
| Ga0193699_102541072 | 3300021363 | Soil | VGTLTRGGMEIEHVDLRYRNGFAARVPGFKERPPKKTG |
| Ga0193750_10093751 | 3300021413 | Soil | LARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA |
| Ga0224452_12815911 | 3300022534 | Groundwater Sediment | FVAAHDRTIGALARAGRPITQVDLRYRNGFAARVPGFREKPTTKS |
| Ga0247751_10554872 | 3300023069 | Soil | TIGALARGGTRVAEVDLRYRNGFAARVPGFREKAPRRAEAKD |
| Ga0207695_100464816 | 3300025913 | Corn Rhizosphere | RTMGVLAHAGTHVDRVDLRYRNGFAARMPGFREKPGRKAS |
| Ga0207663_106565511 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AKTVGALARAGTRVEYADLRYRNGFAARVPGFKERAVKKAA |
| Ga0207660_116750391 | 3300025917 | Corn Rhizosphere | RTIRLLAHNGTHIDRVDLRYRNGFAARMPNFHEKPARKVS |
| Ga0207687_112066531 | 3300025927 | Miscanthus Rhizosphere | AVYTRTVGVLARTGKPVDHVDLRYRNGFAARMPEFREKPVRKLS |
| Ga0207690_111604381 | 3300025932 | Corn Rhizosphere | AYRGTIGVLARSGTRVETVDLRYRNGYAVRVPAFREKIMKPAA |
| Ga0207689_110449051 | 3300025942 | Miscanthus Rhizosphere | VGVLARTGKPLDHVDLRYRNGFAARMPEFREKPVRKLS |
| Ga0207667_105387821 | 3300025949 | Corn Rhizosphere | TRVLARTGTRVERVDLRYRNGFAAQMPGFREKPARKVS |
| Ga0207640_120366152 | 3300025981 | Corn Rhizosphere | LARTGKPVDHVDLRYRNGFAARMPEFREKPVRKLS |
| Ga0207658_104639812 | 3300025986 | Switchgrass Rhizosphere | DRTVGALARAGRPVNEVDLRYRSGFAARVPGFREKPAKKT |
| Ga0207677_101131943 | 3300026023 | Miscanthus Rhizosphere | RTVAVLARAGKRVEHVDLRYRSGFAAQMPGFREKATRKVS |
| Ga0207641_105220202 | 3300026088 | Switchgrass Rhizosphere | ARAGTRVDRVDLRYRNGFAARVPGFRERPAKKAGAA |
| Ga0256808_10473691 | 3300026476 | Sediment | GALARQGTRVDYVDLRYRNGFAARVPGLREAPAKSGV |
| Ga0256806_10019453 | 3300026501 | Sediment | RTIGALARQGTRVDYVDLRYRNGFAARVPGLREAPAKSGV |
| Ga0209805_10780971 | 3300026542 | Soil | YAKTIGALARAGTRVEYVDLRYRNGFAARVPEFKERAVKKAA |
| Ga0209474_107709271 | 3300026550 | Soil | GAVHDRTIGALARAGRHIEQVDLRYRNGFAARVPGFREKPAKKS |
| Ga0209969_10501872 | 3300027360 | Arabidopsis Thaliana Rhizosphere | ARTVAVLARTGKRVDHVDLRYRNGFAARMPGFREKAQRKT |
| Ga0209971_10212142 | 3300027682 | Arabidopsis Thaliana Rhizosphere | VYARTIAVLARAGTQVDRVDLRYRNGFAARLPGFREKPQRKAS |
| Ga0209580_102328291 | 3300027842 | Surface Soil | TIAALARGGTHVDYVDLRYRNGFAVRVLEATEKPSRRTG |
| Ga0209397_100282123 | 3300027871 | Wetland | IAAYGRTVGALARAGTRIEYVDMRYRNGFAARVPGFKERPPKKAA |
| Ga0209974_100233321 | 3300027876 | Arabidopsis Thaliana Rhizosphere | YARTVGALARGGTRVADVDLRYRNGFAARVPGFREKPARRAD |
| Ga0209069_103624562 | 3300027915 | Watersheds | ERTIGALARAQTNIEHVDLRYRNGFAARVPGFRERPPKKAA |
| Ga0268266_105721032 | 3300028379 | Switchgrass Rhizosphere | FVGAYDRTIAALARAGTRIEHVDLRYRNGFAARVPGFRERAPKRAA |
| Ga0247818_102515732 | 3300028589 | Soil | IPAFARTGKPVDHVDLRYRNGFAARMPGFREKPPRKVS |
| Ga0311337_111727002 | 3300030000 | Fen | TRVEQVDLRYRNGFAARVPEFREAAAKKPAADQLRNKH |
| Ga0302172_100540271 | 3300030003 | Fen | VYGRTIQALARAGTRVDRVDLRYRNGFAARVPGFHERPAKKAGAA |
| Ga0311348_103301202 | 3300030019 | Fen | QPRTLGTLERAGTHVDYVDLRYRNGFAARVPKFREKTARPAA |
| Ga0311333_100523701 | 3300030114 | Fen | AAQPRTLGTLARAGTHVDYVDLRYRNGFAARVPKFREKTVKPAA |
| Ga0311333_115431771 | 3300030114 | Fen | QPRTLGVLARAGTRVDYVDLRYRNGFAARVPQFREKSVKPHA |
| Ga0311335_100479371 | 3300030838 | Fen | PRTLGALARSGTRVDYVDLRYRNGFAARVPQFREKAVKPHA |
| Ga0307498_103996202 | 3300031170 | Soil | RQTLGALARAGTRVDVVDLRYRNGFAARVPAFREKIVKPAA |
| Ga0170824_1166073612 | 3300031231 | Forest Soil | GLAGVYARTVGALVSAGTKVDYVDLRYRAGFAARVPGFREKLPKKLA |
| Ga0318501_104668981 | 3300031736 | Soil | TIGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG |
| Ga0318554_106071931 | 3300031765 | Soil | SSTLAALARAGTPVEHVDLRYRNGFAVRMPGFTARPSARRPT |
| Ga0318497_104221561 | 3300031805 | Soil | AVYERTIGALARAGTRIEHVDLRYHNGFAARVPGFRERTRKKA |
| Ga0307413_100678211 | 3300031824 | Rhizosphere | FAAAYARTIAALSRQGTRVEYVDLRYRNGFAARLPGFREGAKKPGT |
| Ga0306925_105530871 | 3300031890 | Soil | AYDRTIGALARANRGVEQVDLRYRNGFAARVPGFREKPSKKS |
| Ga0302322_1018419911 | 3300031902 | Fen | PRTLGTLARTGTHVDYVDLRYRNGFAIRVPQFREKTVKPAA |
| Ga0308175_1010326982 | 3300031938 | Soil | RTVGVLARTGKPVDRVDLRYRNGFAARMPEFREKPSRKVS |
| Ga0310912_100554251 | 3300031941 | Soil | RTIGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG |
| Ga0310885_100073091 | 3300031943 | Soil | LARSGTRVADVDLRYRNGFTARVPGFREKPARRAD |
| Ga0318562_100729753 | 3300032008 | Soil | ATAYPRTLAALASVGTHVDHVDLRYRNGFAARVPGFKERAAPKRG |
| Ga0318562_103619122 | 3300032008 | Soil | PRTLGALARAGTRVEYVDLRYRNGFAVRVPGFVEKTPKKGG |
| Ga0310899_106870292 | 3300032017 | Soil | AYARTVGALVRNGTRVADVDLRYRNGFTARVPGFREKPARRAD |
| Ga0318570_102049922 | 3300032054 | Soil | IGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG |
| Ga0318553_101676401 | 3300032068 | Soil | YERTIGALARTGTGIEHVDLRYRNGFAARVPGFRERVRKKG |
| Ga0315287_110877191 | 3300032397 | Sediment | AALARAGTRIEYVDLRYRNGFAARVPGFRERPAKRGA |
| Ga0310812_102338201 | 3300032421 | Soil | YARTVGVLARTGKPVDHVDLRYRNGFAARMPGFREKPPRKVS |
| Ga0316622_1029525662 | 3300033416 | Soil | ALARAGTRIEYVDMRYRNGFAARVPGFKERPPKKAA |
| Ga0316626_104876811 | 3300033485 | Soil | VVAYGRTIGALTRQGTRVDHVDLRYRNGFAARVPGLREAPAKSGA |
| Ga0370493_0185788_1_108 | 3300034129 | Untreated Peat Soil | LEKGGTRIDRVDLRYRNGFAARVPNFKERPPKKAA |
| Ga0370493_0309891_431_541 | 3300034129 | Untreated Peat Soil | ALARAGTRVDYVDLRYRNGFAARIPQFREKSAKPAA |
| Ga0370481_0106349_11_127 | 3300034281 | Untreated Peat Soil | VGALARAGTAVATVDLRYRNGFAARIPGFREKPAKKAA |
| Ga0364943_0381747_392_529 | 3300034354 | Sediment | VYERTIDALARAGTRVEHVDLRYRNGFAARVPGFQERAAKKKATG |
| ⦗Top⦘ |