| Basic Information | |
|---|---|
| Family ID | F088837 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LVVPPETPHGFRNTGDGPLLVVSVHESGTLQQTFLGEEPA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.01 % |
| % of genes near scaffold ends (potentially truncated) | 88.07 % |
| % of genes from short scaffolds (< 2000 bps) | 95.41 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.991 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.193 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.284 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 10.09 |
| PF00501 | AMP-binding | 6.42 |
| PF00561 | Abhydrolase_1 | 5.50 |
| PF00850 | Hist_deacetyl | 3.67 |
| PF03795 | YCII | 2.75 |
| PF07237 | DUF1428 | 2.75 |
| PF12704 | MacB_PCD | 2.75 |
| PF12840 | HTH_20 | 2.75 |
| PF12697 | Abhydrolase_6 | 2.75 |
| PF13147 | Obsolete Pfam Family | 1.83 |
| PF02518 | HATPase_c | 1.83 |
| PF07478 | Dala_Dala_lig_C | 1.83 |
| PF09992 | NAGPA | 1.83 |
| PF00196 | GerE | 1.83 |
| PF02515 | CoA_transf_3 | 0.92 |
| PF10604 | Polyketide_cyc2 | 0.92 |
| PF13193 | AMP-binding_C | 0.92 |
| PF08530 | PepX_C | 0.92 |
| PF01266 | DAO | 0.92 |
| PF07730 | HisKA_3 | 0.92 |
| PF00916 | Sulfate_transp | 0.92 |
| PF02796 | HTH_7 | 0.92 |
| PF00296 | Bac_luciferase | 0.92 |
| PF02535 | Zip | 0.92 |
| PF13460 | NAD_binding_10 | 0.92 |
| PF10094 | DUF2332 | 0.92 |
| PF13594 | Obsolete Pfam Family | 0.92 |
| PF01609 | DDE_Tnp_1 | 0.92 |
| PF03459 | TOBE | 0.92 |
| PF04542 | Sigma70_r2 | 0.92 |
| PF13699 | DUF4157 | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF13376 | OmdA | 0.92 |
| PF06202 | GDE_C | 0.92 |
| PF01564 | Spermine_synth | 0.92 |
| PF12802 | MarR_2 | 0.92 |
| PF00581 | Rhodanese | 0.92 |
| PF01979 | Amidohydro_1 | 0.92 |
| PF03950 | tRNA-synt_1c_C | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.34 |
| COG5507 | Uncharacterized conserved protein YbaA, DUF1428 family | Function unknown [S] | 2.75 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.75 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.92 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.92 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.92 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.92 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.92 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.92 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.92 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.92 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.92 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.92 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.92 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.92 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.92 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.92 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.92 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.92 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.92 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.99 % |
| Unclassified | root | N/A | 11.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459007|GKWS7RC02F4DY9 | Not Available | 519 | Open in IMG/M |
| 2170459009|GA8DASG02IB5CK | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 2189573003|GZIR7W402GZVFR | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300004081|Ga0063454_101740888 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300004114|Ga0062593_101855412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300004157|Ga0062590_100369689 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300004479|Ga0062595_101467031 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004479|Ga0062595_102535699 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004643|Ga0062591_101023212 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005179|Ga0066684_10570625 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005330|Ga0070690_100173834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1484 | Open in IMG/M |
| 3300005341|Ga0070691_11065859 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005347|Ga0070668_101077634 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005353|Ga0070669_100727845 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005355|Ga0070671_100319025 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300005364|Ga0070673_100850574 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005434|Ga0070709_11694074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 516 | Open in IMG/M |
| 3300005438|Ga0070701_10753600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300005535|Ga0070684_100623232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300005543|Ga0070672_102103748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300005587|Ga0066654_10270756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 901 | Open in IMG/M |
| 3300005616|Ga0068852_100543218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1162 | Open in IMG/M |
| 3300005764|Ga0066903_100697184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1789 | Open in IMG/M |
| 3300005764|Ga0066903_102587004 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300005841|Ga0068863_101569239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300006028|Ga0070717_11371647 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006046|Ga0066652_101451032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300006048|Ga0075363_100973256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300006606|Ga0074062_12928950 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300006806|Ga0079220_11734191 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006845|Ga0075421_101040392 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300006969|Ga0075419_11455475 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009093|Ga0105240_11295873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300009098|Ga0105245_10887454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 933 | Open in IMG/M |
| 3300009147|Ga0114129_12725751 | Not Available | 588 | Open in IMG/M |
| 3300009148|Ga0105243_11621058 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009174|Ga0105241_12610187 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009553|Ga0105249_10222197 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300009789|Ga0126307_10427693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1068 | Open in IMG/M |
| 3300009789|Ga0126307_10768118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| 3300010037|Ga0126304_10761029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia geojensis | 656 | Open in IMG/M |
| 3300010038|Ga0126315_10422186 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300010041|Ga0126312_11149736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300010375|Ga0105239_11502725 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300010376|Ga0126381_103602316 | Not Available | 607 | Open in IMG/M |
| 3300010399|Ga0134127_12217679 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300011991|Ga0120153_1088385 | Not Available | 506 | Open in IMG/M |
| 3300012093|Ga0136632_10458835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300012200|Ga0137382_10794168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300012201|Ga0137365_11118037 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012929|Ga0137404_11751214 | Not Available | 577 | Open in IMG/M |
| 3300012951|Ga0164300_10325250 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012984|Ga0164309_10542164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 898 | Open in IMG/M |
| 3300013306|Ga0163162_11077206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300013307|Ga0157372_13258338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300015077|Ga0173483_10068324 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300015371|Ga0132258_13350431 | Not Available | 1101 | Open in IMG/M |
| 3300018028|Ga0184608_10365280 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300018051|Ga0184620_10126702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300018061|Ga0184619_10485058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia geojensis | 547 | Open in IMG/M |
| 3300018066|Ga0184617_1014010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1670 | Open in IMG/M |
| 3300018072|Ga0184635_10418813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300018432|Ga0190275_11160675 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300018432|Ga0190275_12129376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 639 | Open in IMG/M |
| 3300018468|Ga0066662_11976177 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300019377|Ga0190264_10795516 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021478|Ga0210402_10624756 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300025899|Ga0207642_10441566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium SCGC AG-212-D09 | 786 | Open in IMG/M |
| 3300025908|Ga0207643_10079654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1896 | Open in IMG/M |
| 3300025911|Ga0207654_10149716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
| 3300025919|Ga0207657_11033413 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025924|Ga0207694_10061607 | All Organisms → cellular organisms → Bacteria | 2920 | Open in IMG/M |
| 3300025931|Ga0207644_11771033 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300025932|Ga0207690_11309753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300025936|Ga0207670_11170927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300025945|Ga0207679_10084809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2432 | Open in IMG/M |
| 3300026088|Ga0207641_12314350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300026142|Ga0207698_10417327 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300026552|Ga0209577_10236923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1382 | Open in IMG/M |
| 3300027761|Ga0209462_10124045 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027765|Ga0209073_10162332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 831 | Open in IMG/M |
| 3300027775|Ga0209177_10432878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300027907|Ga0207428_10922084 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300027909|Ga0209382_11877141 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300028589|Ga0247818_11267508 | Not Available | 528 | Open in IMG/M |
| 3300028592|Ga0247822_10845628 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300028710|Ga0307322_10095139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300028722|Ga0307319_10254080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
| 3300028784|Ga0307282_10603334 | Not Available | 532 | Open in IMG/M |
| 3300028791|Ga0307290_10084566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300028796|Ga0307287_10165949 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300028809|Ga0247824_11009572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 527 | Open in IMG/M |
| 3300028828|Ga0307312_10503554 | Not Available | 799 | Open in IMG/M |
| 3300028875|Ga0307289_10031999 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300028881|Ga0307277_10009309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3781 | Open in IMG/M |
| 3300028889|Ga0247827_10447830 | Not Available | 796 | Open in IMG/M |
| 3300031152|Ga0307501_10169006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300031543|Ga0318516_10420093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300031770|Ga0318521_10354632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300031824|Ga0307413_12003246 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031854|Ga0310904_10711024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300031938|Ga0308175_102324211 | Not Available | 601 | Open in IMG/M |
| 3300031995|Ga0307409_100141515 | Not Available | 2074 | Open in IMG/M |
| 3300032005|Ga0307411_11429898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 634 | Open in IMG/M |
| 3300032180|Ga0307471_104253165 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300033412|Ga0310810_10747095 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300033433|Ga0326726_11453979 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300033551|Ga0247830_11489525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300034090|Ga0326723_0239716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.59% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_05081870 | 2170459007 | Grass Soil | PPETLHGFRNLGEEPLLVVSVHEAPAIVQHFTDREPA |
| F47_11153470 | 2170459009 | Grass Soil | VELEPDHVLVVPALTPHGFRNVGEKPLLVVSVHESGVLDQTFLGIEPA |
| FE2_05088610 | 2189573003 | Grass Soil | AIELGPEGMLVVPPDTPHGFRNVGDVPLLVVSVHERGTLRQTWLGREPA |
| Ga0063454_1017408882 | 3300004081 | Soil | IVPPNTPHGFRNTGASPLLVVSVHESGTLDQTFLGEEPA* |
| Ga0062593_1018554121 | 3300004114 | Soil | VTEAEPDTVIVVPPETLHGFRNIGEEPLLVVSVHESGTLDQTFTDREPA* |
| Ga0062590_1003696891 | 3300004157 | Soil | GRARAGGHAVVPPDTPHGFRNIADVPLLVVSVHERGTLRQTWLGEDPA* |
| Ga0062595_1014670312 | 3300004479 | Soil | PNQMLVVPADTPHGFRNVGDVPLLVVTVHESGRLEQTFLGKEPA* |
| Ga0062595_1025356992 | 3300004479 | Soil | LVPERILVVPANTPHGFRNVGKDPLLVVSVHESGTLEQTFLGREPA* |
| Ga0062591_1010232122 | 3300004643 | Soil | QVLVVPPETPHGFRNTGDRPLLVVSIHESGTLEQTFVGGEPA* |
| Ga0066684_105706252 | 3300005179 | Soil | QMLVVPPETPHGFRNTGEQSLLVVSVHESGTLEQTFLGRDPL* |
| Ga0070690_1001738343 | 3300005330 | Switchgrass Rhizosphere | VVPPDTPHGFRNTGETPLLLFSVHDSGTLEQTFTGDEPA* |
| Ga0070691_110658592 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GPDTVIVVPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0070668_1010776342 | 3300005347 | Switchgrass Rhizosphere | MHPDQMLVVPPNTPHGFRNIGDVPLLTVSIHASGELDQTFLGVNPA* |
| Ga0070669_1007278451 | 3300005353 | Switchgrass Rhizosphere | LHANQMLVVPPETPHGFRNTGEEPLLVVSVHESGTLDQTFLGRDPD* |
| Ga0070671_1003190253 | 3300005355 | Switchgrass Rhizosphere | ANQMLVVPPETPHGFRNTGEEPLLVVSVHESGTLDQTFLG* |
| Ga0070673_1008505741 | 3300005364 | Switchgrass Rhizosphere | IVVPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0070709_116940741 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVVPPETPHGFRNIGEVPLLLVTVHESGTLQQTFLGVEPA* |
| Ga0070701_107536002 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVPPDTPHGFRNTGETPLLLFSVHDSGTLEQTFTGDEPA* |
| Ga0070684_1006232321 | 3300005535 | Corn Rhizosphere | QMLVVPPETPHGFRNTGDGPLLVVSVHEAATLEQTFLGEEPA* |
| Ga0070672_1021037481 | 3300005543 | Miscanthus Rhizosphere | TLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0066654_102707562 | 3300005587 | Soil | PETPHGFRNTGDGPLLVVSVHEAGTLQQTFLGAEPDDV* |
| Ga0068852_1005432182 | 3300005616 | Corn Rhizosphere | VPPETPHGFRNTGGGPLLVVSVHEAGTLQQTFLGEDSDEV* |
| Ga0066903_1006971841 | 3300005764 | Tropical Forest Soil | PPETPHGFRNTGELPLLVVSIHESGSLEQTFLGRDPA* |
| Ga0066903_1025870042 | 3300005764 | Tropical Forest Soil | NQMLVVPPETPHGFRNTGDGPLLVVSVHEAPTLQQTFLGDV* |
| Ga0068863_1015692391 | 3300005841 | Switchgrass Rhizosphere | SIITVPPDTLHGFRNTGREPLLLVSVHESPTLVQEFTDDEPA* |
| Ga0070717_113716471 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DLNANQMLVVPPETPHGFRNTGEHPLLLVSIHESGTLEQTFLGRDPA* |
| Ga0066652_1014510321 | 3300006046 | Soil | PPETLHGFRNIGEDPLLVVSVHESGTLDQTFTDREPA* |
| Ga0075363_1009732561 | 3300006048 | Populus Endosphere | PNTPHGFRNIGDVPLLVVSAHERGTLQQEWLGRDPA* |
| Ga0074062_129289501 | 3300006606 | Soil | ANQMLVVPPDTPHGFRNTGSEPLLVVSIHAAGTLEQTFLGRDPA* |
| Ga0079220_117341911 | 3300006806 | Agricultural Soil | TVELEPEGMLVVPPDTPHGFRNVGDVPLLVVSVHERGTLRQTWLGGDPA* |
| Ga0075421_1010403921 | 3300006845 | Populus Rhizosphere | VIVVPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0075419_114554751 | 3300006969 | Populus Rhizosphere | TVIVVPPETLHGFRNIGEEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0105240_112958731 | 3300009093 | Corn Rhizosphere | QMLVVPPETPHGFRNTGEGPLLLVSVHEGETLQQTFLDGGQ* |
| Ga0105245_108874542 | 3300009098 | Miscanthus Rhizosphere | ETPHGFRNTGEGPLLLVSVHEGETLQQTFLDGGQ* |
| Ga0114129_127257511 | 3300009147 | Populus Rhizosphere | TLHGFRNIGDEPLLVVSVHESGTLDQTFTDDEPA* |
| Ga0105243_116210583 | 3300009148 | Miscanthus Rhizosphere | PPMTLHGFRNIGDEPLLVVSVHERGTLSQEFTDDPPA* |
| Ga0105241_126101872 | 3300009174 | Corn Rhizosphere | PETPHGFRNTGDGPLLVVSVHEAPTLDQTFLGEEPA* |
| Ga0105249_102221972 | 3300009553 | Switchgrass Rhizosphere | VVPADTPHGFRNVSDERLLVVSVHEADAVQQTWLGRDPA* |
| Ga0126307_104276932 | 3300009789 | Serpentine Soil | SVFVVPPATLHGFRNIGDEPLLVVSVHESGTLDQTFTEDEPA* |
| Ga0126307_107681183 | 3300009789 | Serpentine Soil | VVPPETLHGFRNVGDEPLLVVSVHESGTLDQAFTEEEPA* |
| Ga0126304_107610291 | 3300010037 | Serpentine Soil | LVVPPETPHGFRNVGDEPLLVVSVHESGTLDQTFTEDEPA* |
| Ga0126315_104221863 | 3300010038 | Serpentine Soil | RWTAGDQVAEAGPETVIVVPPDTLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0126312_111497363 | 3300010041 | Serpentine Soil | VVPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA* |
| Ga0105239_115027252 | 3300010375 | Corn Rhizosphere | QVLVVPPETPHGFRNTGDRALLVVSVHESGTLEQTFVGGEPA* |
| Ga0126381_1036023161 | 3300010376 | Tropical Forest Soil | TPHGFRNVGDDDLLVVSVHESPVLEQTFLGRDPA* |
| Ga0134127_122176792 | 3300010399 | Terrestrial Soil | VVPPETPHGFRNTGGGPLLVVSVHEAGTLQQTFLGEDSDEV* |
| Ga0120153_10883851 | 3300011991 | Permafrost | ANTLHGFRNIGDVPLLVVSVHESPTLIQEFLDEEPA* |
| Ga0136632_104588351 | 3300012093 | Polar Desert Sand | PDTPHGFRNIGQVPLLVVSVHASGTLRQTWTGGEPA* |
| Ga0137382_107941682 | 3300012200 | Vadose Zone Soil | MLVVPPDTPHGFRNAGDVPLLVVSVHERGTLRQTWLGRDPA* |
| Ga0137365_111180372 | 3300012201 | Vadose Zone Soil | MELHANQMLVVPPQTPHGFWNTGEHPLLVVSIHVSGTLEQRLFGRDPA* |
| Ga0137404_117512141 | 3300012929 | Vadose Zone Soil | TPHGFRNTGTTPLLVVSVHESGALDQTFLGVEPA* |
| Ga0164300_103252501 | 3300012951 | Soil | DLHANQMLVVPSETPHGFRTTGEEPLLVVSVHEAGTLDQTILGRDPA* |
| Ga0164309_105421641 | 3300012984 | Soil | TPHGFRNTGSEPLLVVSIHAAGTLEQTFLGRDPA* |
| Ga0163162_110772062 | 3300013306 | Switchgrass Rhizosphere | MLVVPPNTPHGFRNIGDVPLLTVSIHESGEVDQTFLGVNPA* |
| Ga0157372_132583381 | 3300013307 | Corn Rhizosphere | GRWTAGGQVTEPREDSIVVVPPETLHGFRNIGDVPLLVVSVHESGTLDQTFTDREPA* |
| Ga0173483_100683242 | 3300015077 | Soil | MLVVPPDTPHGFRNVGEVPLLVVTVHESGTLEQEFLGVEPS* |
| Ga0132258_133504311 | 3300015371 | Arabidopsis Rhizosphere | TPHGFRNTGQTPLLLVSVHESGTLEQTFLGIEPS* |
| Ga0184608_103652802 | 3300018028 | Groundwater Sediment | IELEPEQMIVVPPDTPHGFRNIGDVPLLVVSMHERGTLRQTWLGEEPA |
| Ga0184620_101267022 | 3300018051 | Groundwater Sediment | MIVVPPDTPHGFRNVGDVALLVVSVHERGTLRQTWLGEDPA |
| Ga0184619_104850581 | 3300018061 | Groundwater Sediment | ELEPEDMIVVPPDTPHGFRNVGDVALLVVSVHERGTLRQTWLGEDPA |
| Ga0184617_10140103 | 3300018066 | Groundwater Sediment | RDEETVELQPEGMLVVPPATPHGFRNVGHVPLLVVSVHERGTLRQTWLGADPA |
| Ga0184635_104188132 | 3300018072 | Groundwater Sediment | ELEPEGMLVVPPDTPHGFRNIGDVALLVVSVHERGTLRQTWLGEEPA |
| Ga0190275_111606751 | 3300018432 | Soil | MIVVPPDTPHGFRNIGDVPLLVVSAHDSGTLEQTWLDREPA |
| Ga0190275_121293762 | 3300018432 | Soil | PDTPHGFRNIGDVPLLVVSVHESGTMRQEWLGEEPA |
| Ga0066662_119761771 | 3300018468 | Grasslands Soil | LVVPPDTPHGFRNTGDVPLLVVSVHERGTLRQTWLGREPA |
| Ga0190264_107955161 | 3300019377 | Soil | MAVAPPETLHGFRNIGDVPLLVVSVHDRGTLSQDFTDDAPA |
| Ga0210402_106247561 | 3300021478 | Soil | MLVVPPETPHGFRNIGEEPLLVVSVHESGTVQQTFLGRDPA |
| Ga0207642_104415661 | 3300025899 | Miscanthus Rhizosphere | MHPDQMLVVPPNTPHGFRNIGDVPLLTVSIHASGELDQTFLGVNPA |
| Ga0207643_100796541 | 3300025908 | Miscanthus Rhizosphere | MTLHGFRNIGDEPLLVVSVHERGTLSQEFTDDPPA |
| Ga0207654_101497164 | 3300025911 | Corn Rhizosphere | LHANQMLVVPPETPHGFRNTGEEPLLVVSVHESGTLDQTFLGRDPA |
| Ga0207657_110334131 | 3300025919 | Corn Rhizosphere | QMLVVPPETPHGFRNTGDGPLLVVSVHESGTLQQTFLGEEPA |
| Ga0207694_100616071 | 3300025924 | Corn Rhizosphere | VVPPETPHGFRNTGDGPLLVVSVHESGTLQQTFLGEEPA |
| Ga0207644_117710331 | 3300025931 | Switchgrass Rhizosphere | EPDGMAIAPPMTLHGFRNIGDEPLLVVSVHERGTLSQEFTDDPPA |
| Ga0207690_113097531 | 3300025932 | Corn Rhizosphere | QMLVVPPETPHGFRNTGEEPLLVVSVHESGTLDQTFLGRDPD |
| Ga0207670_111709272 | 3300025936 | Switchgrass Rhizosphere | VSLFTPDTPHGFRNTGETPLLLFSVHDSGTLEQTFTGDEPA |
| Ga0207679_100848094 | 3300025945 | Corn Rhizosphere | QMLVVPPETPHGFRNTGDGPLLVVSVHEAPTLEQTFLGEEPA |
| Ga0207641_123143502 | 3300026088 | Switchgrass Rhizosphere | DSIITVPPDTLHGFRNTGREPLLLVSVHESPTLVQEFTDDEPA |
| Ga0207698_104173271 | 3300026142 | Corn Rhizosphere | LVVPPETPHGFRNTGDGPLLVVSVHESGTLQQTFLGEEPA |
| Ga0209577_102369231 | 3300026552 | Soil | DVRAERVISVPAETPHGFRNTGDAPLLVVAIHESPVLVQDFLGREPA |
| Ga0209462_101240453 | 3300027761 | Agave | PPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA |
| Ga0209073_101623321 | 3300027765 | Agricultural Soil | PNQMLVVPPETPHGFRNTGDEPLLVVSVHEAPTLQQTFLREEPA |
| Ga0209177_104328782 | 3300027775 | Agricultural Soil | ADQMLVVPPETPHGFRNTGDQPLLVVSIHESGTLDQTFLGRDPA |
| Ga0207428_109220841 | 3300027907 | Populus Rhizosphere | PMTLHGFRNIGDEPLLVVSVHERGTLSQEFTDDPPA |
| Ga0209382_118771411 | 3300027909 | Populus Rhizosphere | VIVVPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA |
| Ga0247818_112675082 | 3300028589 | Soil | EGMLVVPPDTPHGFRNIGDVPLLLVSVHERGTLRQTWLGREPA |
| Ga0247822_108456281 | 3300028592 | Soil | GETVTELSPNQMLVVPADTPHGFRNVSDVPLLVVTVHESGTLEQTFLGKEPA |
| Ga0307322_100951391 | 3300028710 | Soil | EQMIVVPLDTPHGFRNIGDVPLLVVSMHERGTLRQTWLGEEPA |
| Ga0307319_102540802 | 3300028722 | Soil | MLVVPPETPHGFRNTGEHPLLVVSIHESGRLDQTFLGREPA |
| Ga0307282_106033341 | 3300028784 | Soil | VPPETPHGFRNTGEHPLLVVSIHESGTLDQTFLGREPA |
| Ga0307290_100845661 | 3300028791 | Soil | QPEGMLVVPPDTPHGFRNVGEVPLLVVSVHERGTLRQTWLGEDPA |
| Ga0307287_101659492 | 3300028796 | Soil | WTSGDDVVELEPEGMLVVPPDTPHGFRNIGDVALLVVSVHERGTLRQTWLGEEPA |
| Ga0247824_110095722 | 3300028809 | Soil | PETPHGFRNIGEVPLLVVSVHERGTMRQAWLGRDPE |
| Ga0307312_105035541 | 3300028828 | Soil | MLVVPPDTPHGFRNVGEVPLLVVSVHERGTLRQTWLGEDPA |
| Ga0307289_100319993 | 3300028875 | Soil | VIELEPEQMIVVPPDTPHGFRNIGDVPLLVVSMHERGTLRQTWLGEEPA |
| Ga0307277_100093091 | 3300028881 | Soil | EGMLVVPPDMPHGFRNVGEVPLLVVSVHERGTLRQTWLGEDPA |
| Ga0247827_104478301 | 3300028889 | Soil | VVPPETLHGFRNIGDEELHVLSVHESGTLEQTFTEDEPA |
| Ga0307501_101690062 | 3300031152 | Soil | LGDDEFHDIGDVPLLVVSVHERGTLRQTFLGSDRA |
| Ga0318516_104200932 | 3300031543 | Soil | LCPSQLLVVPPETPHGFRNTGDEPLLVVSVHESGTLDQTFLGRDPV |
| Ga0318521_103546321 | 3300031770 | Soil | QRLVVPPETPHGFRNIGDVPLLVVSVHEAGTVDQTWLGRDPA |
| Ga0307413_120032461 | 3300031824 | Rhizosphere | AEAEPETVIVVPPETLHGFRKIGDEPLLVVSVHESGTLDQTFTEQEPA |
| Ga0310904_107110242 | 3300031854 | Soil | LEPEQILTVPPDTPHGFRNIGDVPLLVVSVHERGTMRQTWLGEEPA |
| Ga0308175_1023242111 | 3300031938 | Soil | VPPDTPHGFRNISDDPLLVVSIHESGTLEQTFLGREPA |
| Ga0307409_1001415153 | 3300031995 | Rhizosphere | VPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEQEPA |
| Ga0307411_114298981 | 3300032005 | Rhizosphere | AVIVVPPETLHGFRNIGDEPLLVVSVHESGTLDQTFTEDEPA |
| Ga0307471_1042531651 | 3300032180 | Hardwood Forest Soil | VVPALTPHGFRNIGEKPLLVVSVHESGVLDQTFLGIEPA |
| Ga0310810_107470952 | 3300033412 | Soil | PDTPHGFRNTGEQPLLVVSVHESGTLDQTFLGRDPA |
| Ga0326726_114539792 | 3300033433 | Peat Soil | WTAGDDIVDLRANQMLVVPPETPHGFLNTGADPLLVVSVHESGTLDQTFLGSDPA |
| Ga0247830_114895251 | 3300033551 | Soil | DEMIVVPPDTPHGFRNVGDVPLLVVSVHERGTLRQTWLGKDPA |
| Ga0326723_0239716_680_805 | 3300034090 | Peat Soil | MLVVPPETPHGFRNTGEQPLLVVSIHESGTLEQTFLGRDPA |
| ⦗Top⦘ |