NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088836

Metagenome / Metatranscriptome Family F088836

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088836
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 45 residues
Representative Sequence FTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Number of Associated Samples 97
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.66 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.193 % of family members)
Environment Ontology (ENVO) Unclassified
(25.688 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.780 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.00%    β-sheet: 20.00%    Coil/Unstructured: 76.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01872RibD_C 81.65
PF07282OrfB_Zn_ribbon 6.42
PF00196GerE 4.59
PF02518HATPase_c 1.83
PF07730HisKA_3 0.92
PF12840HTH_20 0.92
PF00990GGDEF 0.92
PF12323HTH_OrfB_IS605 0.92
PF00005ABC_tran 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 81.65
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 81.65
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.92
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.92
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.92
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.08 %
UnclassifiedrootN/A0.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005179|Ga0066684_10108443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1712Open in IMG/M
3300005329|Ga0070683_101262782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300005436|Ga0070713_100191633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1842Open in IMG/M
3300005437|Ga0070710_10522915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia815Open in IMG/M
3300005437|Ga0070710_10587613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia773Open in IMG/M
3300005468|Ga0070707_100456448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1238Open in IMG/M
3300005617|Ga0068859_100142624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2469Open in IMG/M
3300006028|Ga0070717_10104571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2408Open in IMG/M
3300006606|Ga0074062_12947135All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300006806|Ga0079220_11987307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300006854|Ga0075425_102243158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300006854|Ga0075425_102324043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300006893|Ga0073928_10844644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300006903|Ga0075426_10441065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia963Open in IMG/M
3300007788|Ga0099795_10407761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300009162|Ga0075423_12781020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300009525|Ga0116220_10525470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300009700|Ga0116217_10966691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300010046|Ga0126384_12406783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300010154|Ga0127503_10311863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300010341|Ga0074045_11003432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300010379|Ga0136449_102650795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300010379|Ga0136449_104566568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300010401|Ga0134121_11358200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300012096|Ga0137389_11442794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300012205|Ga0137362_11385080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300012209|Ga0137379_10859282All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300012351|Ga0137386_10065340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2532Open in IMG/M
3300012351|Ga0137386_10844314All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012353|Ga0137367_10051152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae3105Open in IMG/M
3300012910|Ga0157308_10044789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1125Open in IMG/M
3300016319|Ga0182033_10922420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300016371|Ga0182034_11651497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300017932|Ga0187814_10054935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1466Open in IMG/M
3300017937|Ga0187809_10257374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300018047|Ga0187859_10459768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300018085|Ga0187772_11171879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300020581|Ga0210399_11320977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300020581|Ga0210399_11356335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300020582|Ga0210395_10345905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1118Open in IMG/M
3300020582|Ga0210395_10476187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia940Open in IMG/M
3300021180|Ga0210396_11000469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia708Open in IMG/M
3300021181|Ga0210388_11259782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300021377|Ga0213874_10236389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens669Open in IMG/M
3300021401|Ga0210393_10638126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia869Open in IMG/M
3300021403|Ga0210397_10017286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4392Open in IMG/M
3300021475|Ga0210392_11228029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300021478|Ga0210402_11270286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300021478|Ga0210402_12028413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300024254|Ga0247661_1020239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300025911|Ga0207654_11354458All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300025914|Ga0207671_11466229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300025921|Ga0207652_10167891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1968Open in IMG/M
3300025942|Ga0207689_10019012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5794Open in IMG/M
3300025944|Ga0207661_10725942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia914Open in IMG/M
3300026023|Ga0207677_10229909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1493Open in IMG/M
3300026490|Ga0257153_1031671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1090Open in IMG/M
3300026899|Ga0209326_1004499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1051Open in IMG/M
3300027512|Ga0209179_1134253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300027787|Ga0209074_10525569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300027846|Ga0209180_10772609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300027898|Ga0209067_10520624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300028787|Ga0307323_10054124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1415Open in IMG/M
3300028877|Ga0302235_10341647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300029944|Ga0311352_11075584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300029997|Ga0302302_1048745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1877Open in IMG/M
3300029999|Ga0311339_11167984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300030524|Ga0311357_11148421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300030906|Ga0302314_10608819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1140Open in IMG/M
3300031199|Ga0307495_10182348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300031236|Ga0302324_102854727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300031474|Ga0170818_101500655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300031543|Ga0318516_10322969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia891Open in IMG/M
3300031543|Ga0318516_10393039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300031681|Ga0318572_10725241All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300031723|Ga0318493_10428011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300031723|Ga0318493_10596748All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031724|Ga0318500_10408255All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300031753|Ga0307477_10898935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300031771|Ga0318546_10957317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300031771|Ga0318546_11256258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300031819|Ga0318568_10062488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2171Open in IMG/M
3300031832|Ga0318499_10194057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300031845|Ga0318511_10296914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia730Open in IMG/M
3300031879|Ga0306919_11489068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300031890|Ga0306925_10909659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300031897|Ga0318520_11115486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300031910|Ga0306923_10042246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4986Open in IMG/M
3300031939|Ga0308174_10676721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300031941|Ga0310912_10448362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1006Open in IMG/M
3300031942|Ga0310916_11731415Not Available505Open in IMG/M
3300031947|Ga0310909_11546443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300031954|Ga0306926_12006244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300032001|Ga0306922_10967388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia880Open in IMG/M
3300032010|Ga0318569_10512986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300032052|Ga0318506_10467273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300032055|Ga0318575_10361567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens736Open in IMG/M
3300032066|Ga0318514_10337536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria798Open in IMG/M
3300032066|Ga0318514_10417108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300032074|Ga0308173_10748017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia896Open in IMG/M
3300032091|Ga0318577_10558269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300032180|Ga0307471_101146266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia943Open in IMG/M
3300032770|Ga0335085_11207869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia803Open in IMG/M
3300032783|Ga0335079_12325234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300032892|Ga0335081_12605782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300032897|Ga0335071_10619787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1033Open in IMG/M
3300032954|Ga0335083_10265843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300032955|Ga0335076_10495176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300032955|Ga0335076_11684587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.42%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.92%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.92%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026899Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066684_1010844313300005179SoilLTFTLPEAGYAAGWEVVIDTASGVPGSIHPPKGEIEVRDHAVVVLRSTA*
Ga0070683_10126278213300005329Corn RhizosphereDSSYAAGWEVIVDTAQPRAPATPRAPKDEIEVRDRAVVVLRSTS*
Ga0070713_10019163313300005436Corn, Switchgrass And Miscanthus RhizosphereYAAGWEVVIDTSQPGIPATARAPKDEIEVRDRAVVVLRSTP*
Ga0070710_1052291523300005437Corn, Switchgrass And Miscanthus RhizosphereGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTG*
Ga0070710_1058761323300005437Corn, Switchgrass And Miscanthus RhizosphereFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTQ*
Ga0070707_10045644833300005468Corn, Switchgrass And Miscanthus RhizosphereFNAHSKPLMFTLPEAGYAPGWEVIIDTASGVPGAIHPPKNEIEVRDHAVVVLRSTE*
Ga0068859_10014262413300005617Switchgrass RhizosphereVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE*
Ga0070717_1010457143300006028Corn, Switchgrass And Miscanthus RhizosphereGYAAGWEVVVDTAQPGVRGTARAPKDEIEVRDRAVVVLRSSG*
Ga0074062_1294713513300006606SoilVIIDTASGVPGAIHPPKEEIEVRDHAVVVLRSSD*
Ga0079220_1198730723300006806Agricultural SoilPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTE*
Ga0075425_10224315823300006854Populus RhizosphereYAAGWEVVIDTADQMPGAIHPPKKEIEVCDRAVVVLRSTE*
Ga0075425_10232404323300006854Populus RhizosphereSYAAGWEVVIDTSQPGIPATARAPKDEIEVRDRAVVVLRSTP*
Ga0073928_1084464413300006893Iron-Sulfur Acid SpringTFTLPEASYAAGWEVVIDTAFGITGTVHAPKKEIEVCDRAIVVLRSTE*
Ga0075426_1044106513300006903Populus RhizosphereYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTE*
Ga0099795_1040776123300007788Vadose Zone SoilNAHSKPLTFTLPEAAYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA*
Ga0075423_1278102013300009162Populus RhizosphereHSKPLTFTLPEADYAAGWEVVIDTADQMPGAIHPPKKEIEVCDRAVVVLRSAQ*
Ga0116220_1052547023300009525Peatlands SoilEVVIDTGLGVPGAIHPPKKEIEVRDHAVVVLRSTE*
Ga0116217_1096669123300009700Peatlands SoilWEVVIDTSLSATGTIYLPKSEVEVRDHAVVLLRSTE*
Ga0126384_1240678323300010046Tropical Forest SoilTFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTQ*
Ga0127503_1031186313300010154SoilAHSKPLTFTLPEPGYAAGWEVVIDTASGVPGAIHPPRKEIEVRDHAVVVLRSTA*
Ga0074045_1100343213300010341Bog Forest SoilNPITFTLPEASYAAGWEVVIDTVLGVPGAIHPPKEEIQVRDHAVVVLRSTE*
Ga0136449_10265079513300010379Peatlands SoilWEVVIDTDPKSLGVPRAIHPPKKEIEVRDHAVVVLRSTE*
Ga0136449_10456656813300010379Peatlands SoilPITFTLPEASYAAGWEVVIDTGLGVAGAIHPPKKEIEVRDHAVVVLRSTE*
Ga0134121_1135820013300010401Terrestrial SoilNAHSKPLTFTLPEAGYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTQ*
Ga0137389_1144279413300012096Vadose Zone SoilLPEASYAAGWEVVIDTARGVPGAIHPPKKEIEVGDRAVVVLRSAE*
Ga0137362_1138508013300012205Vadose Zone SoilAHSKPLTFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE*
Ga0137379_1085928223300012209Vadose Zone SoilWEVVIDTARGVPGAIHPPRKEIEVCDRAVVVLRSAD*
Ga0137386_1006534013300012351Vadose Zone SoilYAAGWEVIIDTSSGVPGAIHPPKKEIEVRDHAVVVLRSTE*
Ga0137386_1084431423300012351Vadose Zone SoilNPLTFTLPEASYAAGWEVVIDTARGVPGAIHPPRKEIEVCDRAVVVLRSAD*
Ga0137367_1005115263300012353Vadose Zone SoilFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTG*
Ga0157308_1004478913300012910SoilTFTLPEAGYAAAWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA*
Ga0182033_1092242013300016319SoilEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTK
Ga0182034_1165149713300016371SoilSKALTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0187814_1005493533300017932Freshwater SedimentVIDTDPKSLGVPGAIHLPKKEIEVRDHAVVVLRSTE
Ga0187809_1025737423300017937Freshwater SedimentASWEVVIDTAQPGVTGTARAPKDEIEVRDRAVVVLRSTA
Ga0187859_1045976813300018047PeatlandLPEASFATGWEAVIDTALGLTGSVHMPKSDIEVCDRTVVVLRSTE
Ga0187772_1117187923300018085Tropical PeatlandASYAASWEVIIDTALGMPGVILPPKKEIEVCDRSVVVLRSTG
Ga0210399_1132097713300020581SoilWEVVIDTASGVPGAIHPPRKEIEVRDHAVVVLRSTA
Ga0210399_1135633513300020581SoilNAHSKPLTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTE
Ga0210395_1034590533300020582SoilNNPITFTLPEASYAVGWEVVIDTDPKSPGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0210395_1047618723300020582SoilEVGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0210396_1100046923300021180SoilGLAHNNPITFTLPEASYAVGWEVVIDTDPKSLGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0210388_1125978223300021181SoilLPEASFATGWEAVIDTAFGLTGSAHMPKSQIEVCDRAVVVLRSTE
Ga0213874_1023638923300021377Plant RootsSYAAGWEVVIDTAAEVPRAIHPPKREIDVGDHAVVVLRSTQ
Ga0210393_1063812633300021401SoilFTLPEASYAVGWEVVIDTDPKSLGVPGAIHPPKKEIEVRDHAVIVLRSTE
Ga0210397_1001728613300021403SoilLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0210392_1122802913300021475SoilYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0210402_1127028623300021478SoilLTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0210402_1202841323300021478SoilGWEVVIDTALGVLGAIHPPKKEIEVGDRAVVVLRSTE
Ga0247661_102023913300024254SoilYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0207654_1135445813300025911Corn RhizosphereIDTASKPPPEPGTVRPPKDEIEVRDRAVVVLRSTS
Ga0207671_1146622913300025914Corn RhizosphereAHSKPLTFTLPEADYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0207652_1016789143300025921Corn RhizosphereGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0207689_1001901213300025942Miscanthus RhizosphereKPLTFTLPEAGYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0207661_1072594213300025944Corn RhizosphereSNPLTFTLPDSSYAAGWEVIVDTAQPRAPATPRAPKDEIEVRDRAVVVLRSTS
Ga0207677_1022990913300026023Miscanthus RhizosphereAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0257153_103167133300026490SoilKPLMFTLPEAGYAPGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTK
Ga0209326_100449913300026899Forest SoilLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTG
Ga0209179_113425323300027512Vadose Zone SoilNAHSKPLTFTLPEAAYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTG
Ga0209074_1052556913300027787Agricultural SoilYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTQ
Ga0209180_1077260913300027846Vadose Zone SoilLTFTLPEASYAAGWEVVIDTARGVPGAIHPPRKEIEVCDRAVVVLRSAD
Ga0209067_1052062413300027898WatershedsTFTLPEASYAAGWEVVIDTGLGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0307323_1005412433300028787SoilGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0302235_1034164723300028877PalsaAGWEAVIDTAFGLTGSVHMPKSQLEVCDRAVVVLRSTE
Ga0311352_1107558413300029944PalsaEASFAAGWEVVIDTDLGIAGSVHAPKKEIEVCDRAVIVLRSTE
Ga0302302_104874533300029997PalsaTGWEAVVDTAFALTGSAHKPKSQIEVCDRAVVVLRSTE
Ga0311339_1116798413300029999PalsaWEVVIDTALGLAGSVHAPKKEIDVCDRAVVVLRSTE
Ga0311357_1114842123300030524PalsaTFTLPEASFAAGWEAVIDTAFGLTGSVHMPKSQLEVCDRAVVVLRSTE
Ga0302314_1060881933300030906PalsaTFTLPEASFAAGWEVVIDTDLGIAGSVHAPKKEIEVCDRAVIVLRSTE
Ga0307495_1018234823300031199SoilHSKPLTFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTA
Ga0302324_10285472713300031236PalsaAGWEVVIDTALGLAGSVHAPKKEIDVCDRAVVVLRSTE
Ga0170818_10150065523300031474Forest SoilAGWEVIIDTASGVLGAIHPPRKEIEVRDHAVVVLRSTG
Ga0318516_1032296913300031543SoilGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD
Ga0318516_1039303913300031543SoilGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0318572_1072524123300031681SoilTLPEGSYAAGWEVLIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA
Ga0318493_1042801123300031723SoilEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0318493_1059674823300031723SoilTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0318500_1040825523300031724SoilSKPLTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0307477_1089893513300031753Hardwood Forest SoilFTLPEASYAVGWEVVIDTDPKSPGVPGAIHPPKKEIEVRDHAVVVLRSTQ
Ga0318546_1095731713300031771SoilPLTFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0318546_1125625823300031771SoilPEASYAAGWEVIIDTAQGVPGAIHPPKKEIEVCDRAVIVLRSAE
Ga0318568_1006248813300031819SoilFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0318499_1019405723300031832SoilSMPLTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDHAVAVLRSTE
Ga0318511_1029691423300031845SoilTFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE
Ga0306919_1148906813300031879SoilWEVVIDTATGVAGAIHPPKEEIEVGDRAVVVLRSTE
Ga0306925_1090965913300031890SoilLTFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE
Ga0318520_1111548623300031897SoilFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0306923_1004224663300031910SoilASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE
Ga0308174_1067672113300031939SoilGYAAGWEVVIDTGRKAPPEPGTVRPPKDEIEVLDRAVVVLRSCG
Ga0310912_1044836213300031941SoilEASYAAGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD
Ga0310916_1173141523300031942SoilAGWEVLIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA
Ga0310909_1154644313300031947SoilLTFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0306926_1200624413300031954SoilKPLTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0306922_1096738823300032001SoilSYAAGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD
Ga0318569_1051298613300032010SoilTFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0318506_1046727323300032052SoilAHSKPLTFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE
Ga0318575_1036156723300032055SoilHTFTLPEASYAAGWEVVIDTAFGVPGAIHPPKKEIEVCDRAVIVLRSAE
Ga0318514_1033753613300032066SoilAHSNPLTFTLPGASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSAD
Ga0318514_1041710813300032066SoilEVIIDTAQGVPGAIHPPKKEIEVCDRAVIVLRSAE
Ga0308173_1074801713300032074SoilHSKPLTFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA
Ga0318577_1055826923300032091SoilAHSKPLTFTLPEASYAAGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD
Ga0307471_10114626623300032180Hardwood Forest SoilPLTFTLPEASYAAGWEVVIDTARGVPGAIHPPSKEIEVCDRAMVVLRSTG
Ga0335085_1120786913300032770SoilTFTLPEASYAAGWEVLIDTASGVPGAIHPPKKEIEVRDHAMAVLRSTA
Ga0335079_1232523413300032783SoilWEIVIDTAHPGVPGAVRPPKDEIEVRDRSVVVLRSTS
Ga0335081_1260578223300032892SoilAHSKPLTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE
Ga0335071_1061978713300032897SoilYAAGWEVVIDTASGVPGAIHPPKKQIEVRDRAVVVLRSTP
Ga0335083_1026584333300032954SoilPEASYAAGWEVLIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA
Ga0335076_1049517613300032955SoilTLPEASYAAGWEVVVDTAQGLPGTVHPPKQEIEVRDRAVVVLRSTE
Ga0335076_1168458713300032955SoilLPEAAYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.