| Basic Information | |
|---|---|
| Family ID | F088836 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | FTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.66 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.193 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.780 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.00% β-sheet: 20.00% Coil/Unstructured: 76.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 81.65 |
| PF07282 | OrfB_Zn_ribbon | 6.42 |
| PF00196 | GerE | 4.59 |
| PF02518 | HATPase_c | 1.83 |
| PF07730 | HisKA_3 | 0.92 |
| PF12840 | HTH_20 | 0.92 |
| PF00990 | GGDEF | 0.92 |
| PF12323 | HTH_OrfB_IS605 | 0.92 |
| PF00005 | ABC_tran | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 81.65 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 81.65 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.92 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.92 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.92 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.08 % |
| Unclassified | root | N/A | 0.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005179|Ga0066684_10108443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1712 | Open in IMG/M |
| 3300005329|Ga0070683_101262782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300005436|Ga0070713_100191633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1842 | Open in IMG/M |
| 3300005437|Ga0070710_10522915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300005437|Ga0070710_10587613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300005468|Ga0070707_100456448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1238 | Open in IMG/M |
| 3300005617|Ga0068859_100142624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2469 | Open in IMG/M |
| 3300006028|Ga0070717_10104571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2408 | Open in IMG/M |
| 3300006606|Ga0074062_12947135 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300006806|Ga0079220_11987307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300006854|Ga0075425_102243158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300006854|Ga0075425_102324043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300006893|Ga0073928_10844644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300006903|Ga0075426_10441065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300007788|Ga0099795_10407761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300009162|Ga0075423_12781020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300009525|Ga0116220_10525470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300009700|Ga0116217_10966691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300010046|Ga0126384_12406783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300010154|Ga0127503_10311863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300010341|Ga0074045_11003432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300010379|Ga0136449_102650795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300010379|Ga0136449_104566568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300010401|Ga0134121_11358200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300012096|Ga0137389_11442794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300012205|Ga0137362_11385080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300012209|Ga0137379_10859282 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012351|Ga0137386_10065340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2532 | Open in IMG/M |
| 3300012351|Ga0137386_10844314 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012353|Ga0137367_10051152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 3105 | Open in IMG/M |
| 3300012910|Ga0157308_10044789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300016319|Ga0182033_10922420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300016371|Ga0182034_11651497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300017932|Ga0187814_10054935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1466 | Open in IMG/M |
| 3300017937|Ga0187809_10257374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300018047|Ga0187859_10459768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300018085|Ga0187772_11171879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300020581|Ga0210399_11320977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300020581|Ga0210399_11356335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300020582|Ga0210395_10345905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300020582|Ga0210395_10476187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
| 3300021180|Ga0210396_11000469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300021181|Ga0210388_11259782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300021377|Ga0213874_10236389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 669 | Open in IMG/M |
| 3300021401|Ga0210393_10638126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300021403|Ga0210397_10017286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4392 | Open in IMG/M |
| 3300021475|Ga0210392_11228029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300021478|Ga0210402_11270286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300021478|Ga0210402_12028413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300024254|Ga0247661_1020239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300025911|Ga0207654_11354458 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025914|Ga0207671_11466229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300025921|Ga0207652_10167891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1968 | Open in IMG/M |
| 3300025942|Ga0207689_10019012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5794 | Open in IMG/M |
| 3300025944|Ga0207661_10725942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300026023|Ga0207677_10229909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1493 | Open in IMG/M |
| 3300026490|Ga0257153_1031671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1090 | Open in IMG/M |
| 3300026899|Ga0209326_1004499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1051 | Open in IMG/M |
| 3300027512|Ga0209179_1134253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300027787|Ga0209074_10525569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300027846|Ga0209180_10772609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300027898|Ga0209067_10520624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300028787|Ga0307323_10054124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
| 3300028877|Ga0302235_10341647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300029944|Ga0311352_11075584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300029997|Ga0302302_1048745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1877 | Open in IMG/M |
| 3300029999|Ga0311339_11167984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300030524|Ga0311357_11148421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300030906|Ga0302314_10608819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
| 3300031199|Ga0307495_10182348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300031236|Ga0302324_102854727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300031474|Ga0170818_101500655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300031543|Ga0318516_10322969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
| 3300031543|Ga0318516_10393039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300031681|Ga0318572_10725241 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031723|Ga0318493_10428011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300031723|Ga0318493_10596748 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031724|Ga0318500_10408255 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031753|Ga0307477_10898935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300031771|Ga0318546_10957317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300031771|Ga0318546_11256258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031819|Ga0318568_10062488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2171 | Open in IMG/M |
| 3300031832|Ga0318499_10194057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300031845|Ga0318511_10296914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300031879|Ga0306919_11489068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300031890|Ga0306925_10909659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300031897|Ga0318520_11115486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300031910|Ga0306923_10042246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4986 | Open in IMG/M |
| 3300031939|Ga0308174_10676721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300031941|Ga0310912_10448362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1006 | Open in IMG/M |
| 3300031942|Ga0310916_11731415 | Not Available | 505 | Open in IMG/M |
| 3300031947|Ga0310909_11546443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300031954|Ga0306926_12006244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300032001|Ga0306922_10967388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 880 | Open in IMG/M |
| 3300032010|Ga0318569_10512986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300032052|Ga0318506_10467273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300032055|Ga0318575_10361567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 736 | Open in IMG/M |
| 3300032066|Ga0318514_10337536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300032066|Ga0318514_10417108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300032074|Ga0308173_10748017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300032091|Ga0318577_10558269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300032180|Ga0307471_101146266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300032770|Ga0335085_11207869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 803 | Open in IMG/M |
| 3300032783|Ga0335079_12325234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300032892|Ga0335081_12605782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300032897|Ga0335071_10619787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
| 3300032954|Ga0335083_10265843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
| 3300032955|Ga0335076_10495176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300032955|Ga0335076_11684587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066684_101084431 | 3300005179 | Soil | LTFTLPEAGYAAGWEVVIDTASGVPGSIHPPKGEIEVRDHAVVVLRSTA* |
| Ga0070683_1012627821 | 3300005329 | Corn Rhizosphere | DSSYAAGWEVIVDTAQPRAPATPRAPKDEIEVRDRAVVVLRSTS* |
| Ga0070713_1001916331 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YAAGWEVVIDTSQPGIPATARAPKDEIEVRDRAVVVLRSTP* |
| Ga0070710_105229152 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTG* |
| Ga0070710_105876132 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | FTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTQ* |
| Ga0070707_1004564483 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FNAHSKPLMFTLPEAGYAPGWEVIIDTASGVPGAIHPPKNEIEVRDHAVVVLRSTE* |
| Ga0068859_1001426241 | 3300005617 | Switchgrass Rhizosphere | VIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE* |
| Ga0070717_101045714 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GYAAGWEVVVDTAQPGVRGTARAPKDEIEVRDRAVVVLRSSG* |
| Ga0074062_129471351 | 3300006606 | Soil | VIIDTASGVPGAIHPPKEEIEVRDHAVVVLRSSD* |
| Ga0079220_119873072 | 3300006806 | Agricultural Soil | PEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTE* |
| Ga0075425_1022431582 | 3300006854 | Populus Rhizosphere | YAAGWEVVIDTADQMPGAIHPPKKEIEVCDRAVVVLRSTE* |
| Ga0075425_1023240432 | 3300006854 | Populus Rhizosphere | SYAAGWEVVIDTSQPGIPATARAPKDEIEVRDRAVVVLRSTP* |
| Ga0073928_108446441 | 3300006893 | Iron-Sulfur Acid Spring | TFTLPEASYAAGWEVVIDTAFGITGTVHAPKKEIEVCDRAIVVLRSTE* |
| Ga0075426_104410651 | 3300006903 | Populus Rhizosphere | YAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTE* |
| Ga0099795_104077612 | 3300007788 | Vadose Zone Soil | NAHSKPLTFTLPEAAYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA* |
| Ga0075423_127810201 | 3300009162 | Populus Rhizosphere | HSKPLTFTLPEADYAAGWEVVIDTADQMPGAIHPPKKEIEVCDRAVVVLRSAQ* |
| Ga0116220_105254702 | 3300009525 | Peatlands Soil | EVVIDTGLGVPGAIHPPKKEIEVRDHAVVVLRSTE* |
| Ga0116217_109666912 | 3300009700 | Peatlands Soil | WEVVIDTSLSATGTIYLPKSEVEVRDHAVVLLRSTE* |
| Ga0126384_124067832 | 3300010046 | Tropical Forest Soil | TFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTQ* |
| Ga0127503_103118631 | 3300010154 | Soil | AHSKPLTFTLPEPGYAAGWEVVIDTASGVPGAIHPPRKEIEVRDHAVVVLRSTA* |
| Ga0074045_110034321 | 3300010341 | Bog Forest Soil | NPITFTLPEASYAAGWEVVIDTVLGVPGAIHPPKEEIQVRDHAVVVLRSTE* |
| Ga0136449_1026507951 | 3300010379 | Peatlands Soil | WEVVIDTDPKSLGVPRAIHPPKKEIEVRDHAVVVLRSTE* |
| Ga0136449_1045665681 | 3300010379 | Peatlands Soil | PITFTLPEASYAAGWEVVIDTGLGVAGAIHPPKKEIEVRDHAVVVLRSTE* |
| Ga0134121_113582001 | 3300010401 | Terrestrial Soil | NAHSKPLTFTLPEAGYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTQ* |
| Ga0137389_114427941 | 3300012096 | Vadose Zone Soil | LPEASYAAGWEVVIDTARGVPGAIHPPKKEIEVGDRAVVVLRSAE* |
| Ga0137362_113850801 | 3300012205 | Vadose Zone Soil | AHSKPLTFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE* |
| Ga0137379_108592822 | 3300012209 | Vadose Zone Soil | WEVVIDTARGVPGAIHPPRKEIEVCDRAVVVLRSAD* |
| Ga0137386_100653401 | 3300012351 | Vadose Zone Soil | YAAGWEVIIDTSSGVPGAIHPPKKEIEVRDHAVVVLRSTE* |
| Ga0137386_108443142 | 3300012351 | Vadose Zone Soil | NPLTFTLPEASYAAGWEVVIDTARGVPGAIHPPRKEIEVCDRAVVVLRSAD* |
| Ga0137367_100511526 | 3300012353 | Vadose Zone Soil | FTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTG* |
| Ga0157308_100447891 | 3300012910 | Soil | TFTLPEAGYAAAWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA* |
| Ga0182033_109224201 | 3300016319 | Soil | EASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTK |
| Ga0182034_116514971 | 3300016371 | Soil | SKALTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0187814_100549353 | 3300017932 | Freshwater Sediment | VIDTDPKSLGVPGAIHLPKKEIEVRDHAVVVLRSTE |
| Ga0187809_102573742 | 3300017937 | Freshwater Sediment | ASWEVVIDTAQPGVTGTARAPKDEIEVRDRAVVVLRSTA |
| Ga0187859_104597681 | 3300018047 | Peatland | LPEASFATGWEAVIDTALGLTGSVHMPKSDIEVCDRTVVVLRSTE |
| Ga0187772_111718792 | 3300018085 | Tropical Peatland | ASYAASWEVIIDTALGMPGVILPPKKEIEVCDRSVVVLRSTG |
| Ga0210399_113209771 | 3300020581 | Soil | WEVVIDTASGVPGAIHPPRKEIEVRDHAVVVLRSTA |
| Ga0210399_113563351 | 3300020581 | Soil | NAHSKPLTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTE |
| Ga0210395_103459053 | 3300020582 | Soil | NNPITFTLPEASYAVGWEVVIDTDPKSPGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0210395_104761872 | 3300020582 | Soil | EVGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0210396_110004692 | 3300021180 | Soil | GLAHNNPITFTLPEASYAVGWEVVIDTDPKSLGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0210388_112597822 | 3300021181 | Soil | LPEASFATGWEAVIDTAFGLTGSAHMPKSQIEVCDRAVVVLRSTE |
| Ga0213874_102363892 | 3300021377 | Plant Roots | SYAAGWEVVIDTAAEVPRAIHPPKREIDVGDHAVVVLRSTQ |
| Ga0210393_106381263 | 3300021401 | Soil | FTLPEASYAVGWEVVIDTDPKSLGVPGAIHPPKKEIEVRDHAVIVLRSTE |
| Ga0210397_100172861 | 3300021403 | Soil | LPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0210392_112280291 | 3300021475 | Soil | YAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0210402_112702862 | 3300021478 | Soil | LTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0210402_120284132 | 3300021478 | Soil | GWEVVIDTALGVLGAIHPPKKEIEVGDRAVVVLRSTE |
| Ga0247661_10202391 | 3300024254 | Soil | YAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0207654_113544581 | 3300025911 | Corn Rhizosphere | IDTASKPPPEPGTVRPPKDEIEVRDRAVVVLRSTS |
| Ga0207671_114662291 | 3300025914 | Corn Rhizosphere | AHSKPLTFTLPEADYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0207652_101678914 | 3300025921 | Corn Rhizosphere | GWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0207689_100190121 | 3300025942 | Miscanthus Rhizosphere | KPLTFTLPEAGYAAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0207661_107259421 | 3300025944 | Corn Rhizosphere | SNPLTFTLPDSSYAAGWEVIVDTAQPRAPATPRAPKDEIEVRDRAVVVLRSTS |
| Ga0207677_102299091 | 3300026023 | Miscanthus Rhizosphere | AAGWEVIVDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0257153_10316713 | 3300026490 | Soil | KPLMFTLPEAGYAPGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTK |
| Ga0209326_10044991 | 3300026899 | Forest Soil | LPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTG |
| Ga0209179_11342532 | 3300027512 | Vadose Zone Soil | NAHSKPLTFTLPEAAYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTG |
| Ga0209074_105255691 | 3300027787 | Agricultural Soil | YAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTQ |
| Ga0209180_107726091 | 3300027846 | Vadose Zone Soil | LTFTLPEASYAAGWEVVIDTARGVPGAIHPPRKEIEVCDRAVVVLRSAD |
| Ga0209067_105206241 | 3300027898 | Watersheds | TFTLPEASYAAGWEVVIDTGLGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0307323_100541243 | 3300028787 | Soil | GYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0302235_103416472 | 3300028877 | Palsa | AGWEAVIDTAFGLTGSVHMPKSQLEVCDRAVVVLRSTE |
| Ga0311352_110755841 | 3300029944 | Palsa | EASFAAGWEVVIDTDLGIAGSVHAPKKEIEVCDRAVIVLRSTE |
| Ga0302302_10487453 | 3300029997 | Palsa | TGWEAVVDTAFALTGSAHKPKSQIEVCDRAVVVLRSTE |
| Ga0311339_111679841 | 3300029999 | Palsa | WEVVIDTALGLAGSVHAPKKEIDVCDRAVVVLRSTE |
| Ga0311357_111484212 | 3300030524 | Palsa | TFTLPEASFAAGWEAVIDTAFGLTGSVHMPKSQLEVCDRAVVVLRSTE |
| Ga0302314_106088193 | 3300030906 | Palsa | TFTLPEASFAAGWEVVIDTDLGIAGSVHAPKKEIEVCDRAVIVLRSTE |
| Ga0307495_101823482 | 3300031199 | Soil | HSKPLTFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVSDHAVVVLRSTA |
| Ga0302324_1028547271 | 3300031236 | Palsa | AGWEVVIDTALGLAGSVHAPKKEIDVCDRAVVVLRSTE |
| Ga0170818_1015006552 | 3300031474 | Forest Soil | AGWEVIIDTASGVLGAIHPPRKEIEVRDHAVVVLRSTG |
| Ga0318516_103229691 | 3300031543 | Soil | GWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD |
| Ga0318516_103930391 | 3300031543 | Soil | GWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0318572_107252412 | 3300031681 | Soil | TLPEGSYAAGWEVLIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA |
| Ga0318493_104280112 | 3300031723 | Soil | EVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0318493_105967482 | 3300031723 | Soil | TFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0318500_104082552 | 3300031724 | Soil | SKPLTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0307477_108989351 | 3300031753 | Hardwood Forest Soil | FTLPEASYAVGWEVVIDTDPKSPGVPGAIHPPKKEIEVRDHAVVVLRSTQ |
| Ga0318546_109573171 | 3300031771 | Soil | PLTFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0318546_112562582 | 3300031771 | Soil | PEASYAAGWEVIIDTAQGVPGAIHPPKKEIEVCDRAVIVLRSAE |
| Ga0318568_100624881 | 3300031819 | Soil | FTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0318499_101940572 | 3300031832 | Soil | SMPLTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDHAVAVLRSTE |
| Ga0318511_102969142 | 3300031845 | Soil | TFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE |
| Ga0306919_114890681 | 3300031879 | Soil | WEVVIDTATGVAGAIHPPKEEIEVGDRAVVVLRSTE |
| Ga0306925_109096591 | 3300031890 | Soil | LTFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE |
| Ga0318520_111154862 | 3300031897 | Soil | FTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0306923_100422466 | 3300031910 | Soil | ASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE |
| Ga0308174_106767211 | 3300031939 | Soil | GYAAGWEVVIDTGRKAPPEPGTVRPPKDEIEVLDRAVVVLRSCG |
| Ga0310912_104483621 | 3300031941 | Soil | EASYAAGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD |
| Ga0310916_117314152 | 3300031942 | Soil | AGWEVLIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA |
| Ga0310909_115464431 | 3300031947 | Soil | LTFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0306926_120062441 | 3300031954 | Soil | KPLTFTLPEASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0306922_109673882 | 3300032001 | Soil | SYAAGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD |
| Ga0318569_105129861 | 3300032010 | Soil | TFTLPEASYAAAWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0318506_104672732 | 3300032052 | Soil | AHSKPLTFTLPEASYAAGWEVVIDTAAGVPGAIHPPRKEIEVRDRAVVVLRSTE |
| Ga0318575_103615672 | 3300032055 | Soil | HTFTLPEASYAAGWEVVIDTAFGVPGAIHPPKKEIEVCDRAVIVLRSAE |
| Ga0318514_103375361 | 3300032066 | Soil | AHSNPLTFTLPGASYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSAD |
| Ga0318514_104171081 | 3300032066 | Soil | EVIIDTAQGVPGAIHPPKKEIEVCDRAVIVLRSAE |
| Ga0308173_107480171 | 3300032074 | Soil | HSKPLTFTLPEAGYAAGWEVIIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTA |
| Ga0318577_105582692 | 3300032091 | Soil | AHSKPLTFTLPEASYAAGWEVLIDTAYGVPGAIHPPKKEIEVRDHAVVVLRSTD |
| Ga0307471_1011462662 | 3300032180 | Hardwood Forest Soil | PLTFTLPEASYAAGWEVVIDTARGVPGAIHPPSKEIEVCDRAMVVLRSTG |
| Ga0335085_112078691 | 3300032770 | Soil | TFTLPEASYAAGWEVLIDTASGVPGAIHPPKKEIEVRDHAMAVLRSTA |
| Ga0335079_123252341 | 3300032783 | Soil | WEIVIDTAHPGVPGAVRPPKDEIEVRDRSVVVLRSTS |
| Ga0335081_126057822 | 3300032892 | Soil | AHSKPLTFTLPEAGYAAGWEVVIDTASGVPGAIHPPKKEIEVRDHAVVVLRSTE |
| Ga0335071_106197871 | 3300032897 | Soil | YAAGWEVVIDTASGVPGAIHPPKKQIEVRDRAVVVLRSTP |
| Ga0335083_102658433 | 3300032954 | Soil | PEASYAAGWEVLIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| Ga0335076_104951761 | 3300032955 | Soil | TLPEASYAAGWEVVVDTAQGLPGTVHPPKQEIEVRDRAVVVLRSTE |
| Ga0335076_116845871 | 3300032955 | Soil | LPEAAYAAGWEVVIDTASGVPGAIHPPKKEIEVRDRAVVVLRSTA |
| ⦗Top⦘ |