| Basic Information | |
|---|---|
| Family ID | F088793 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 47 residues |
| Representative Sequence | PRDVISVAFSGPDRKTLYAVSRDNALNKDWIIAIQMIAQGPKGRGK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 96.33 % |
| % of genes from short scaffolds (< 2000 bps) | 94.50 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.394 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.927 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.606 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.202 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.08% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01436 | NHL | 3.67 |
| PF02784 | Orn_Arg_deC_N | 2.75 |
| PF02627 | CMD | 1.83 |
| PF00270 | DEAD | 1.83 |
| PF12706 | Lactamase_B_2 | 1.83 |
| PF12543 | DUF3738 | 1.83 |
| PF00753 | Lactamase_B | 1.83 |
| PF07883 | Cupin_2 | 1.83 |
| PF00675 | Peptidase_M16 | 0.92 |
| PF00226 | DnaJ | 0.92 |
| PF01381 | HTH_3 | 0.92 |
| PF13533 | Biotin_lipoyl_2 | 0.92 |
| PF01799 | Fer2_2 | 0.92 |
| PF02738 | MoCoBD_1 | 0.92 |
| PF08241 | Methyltransf_11 | 0.92 |
| PF13676 | TIR_2 | 0.92 |
| PF07690 | MFS_1 | 0.92 |
| PF02899 | Phage_int_SAM_1 | 0.92 |
| PF07517 | SecA_DEAD | 0.92 |
| PF04185 | Phosphoesterase | 0.92 |
| PF01380 | SIS | 0.92 |
| PF07519 | Tannase | 0.92 |
| PF05163 | DinB | 0.92 |
| PF08327 | AHSA1 | 0.92 |
| PF08450 | SGL | 0.92 |
| PF01717 | Meth_synt_2 | 0.92 |
| PF03544 | TonB_C | 0.92 |
| PF13620 | CarboxypepD_reg | 0.92 |
| PF13186 | SPASM | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF00440 | TetR_N | 0.92 |
| PF00155 | Aminotran_1_2 | 0.92 |
| PF10615 | DUF2470 | 0.92 |
| PF01979 | Amidohydro_1 | 0.92 |
| PF05016 | ParE_toxin | 0.92 |
| PF01144 | CoA_trans | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 2.75 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 2.75 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.83 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.83 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.92 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.92 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.92 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.92 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.92 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.92 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.92 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.92 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101738521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae | 577 | Open in IMG/M |
| 3300004152|Ga0062386_101084888 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300004476|Ga0068966_1430995 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300004635|Ga0062388_101483249 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005336|Ga0070680_100831503 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005364|Ga0070673_100526588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
| 3300005458|Ga0070681_10660523 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005538|Ga0070731_10199439 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300005541|Ga0070733_10679686 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005544|Ga0070686_100403390 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005577|Ga0068857_101685687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300005578|Ga0068854_100826379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 809 | Open in IMG/M |
| 3300005591|Ga0070761_10716017 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005615|Ga0070702_101007272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300005616|Ga0068852_100382419 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300005616|Ga0068852_100966595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300005618|Ga0068864_100602682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300005842|Ga0068858_100466549 | Not Available | 1218 | Open in IMG/M |
| 3300005921|Ga0070766_10480441 | Not Available | 823 | Open in IMG/M |
| 3300006638|Ga0075522_10285477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300006755|Ga0079222_10705084 | Not Available | 800 | Open in IMG/M |
| 3300006755|Ga0079222_11105434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300006806|Ga0079220_11913779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 526 | Open in IMG/M |
| 3300006881|Ga0068865_100785594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 820 | Open in IMG/M |
| 3300006893|Ga0073928_11196659 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300009093|Ga0105240_10513995 | Not Available | 1330 | Open in IMG/M |
| 3300009098|Ga0105245_11415039 | All Organisms → cellular organisms → Bacteria → FCB group | 745 | Open in IMG/M |
| 3300009148|Ga0105243_10397417 | Not Available | 1279 | Open in IMG/M |
| 3300009174|Ga0105241_10550823 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300009239|Ga0103858_10094479 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009254|Ga0103867_1022906 | Not Available | 641 | Open in IMG/M |
| 3300009521|Ga0116222_1054928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1731 | Open in IMG/M |
| 3300010048|Ga0126373_11481121 | Not Available | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11050348 | Not Available | 747 | Open in IMG/M |
| 3300010361|Ga0126378_12667402 | Not Available | 571 | Open in IMG/M |
| 3300010373|Ga0134128_10508843 | Not Available | 1343 | Open in IMG/M |
| 3300010375|Ga0105239_10524387 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300010376|Ga0126381_104152609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 562 | Open in IMG/M |
| 3300010397|Ga0134124_10266148 | Not Available | 1583 | Open in IMG/M |
| 3300012989|Ga0164305_11257632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300014158|Ga0181521_10548041 | Not Available | 548 | Open in IMG/M |
| 3300014169|Ga0181531_10278435 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300014201|Ga0181537_10249924 | Not Available | 1218 | Open in IMG/M |
| 3300014201|Ga0181537_10966720 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014262|Ga0075301_1083299 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300014489|Ga0182018_10336877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300014495|Ga0182015_10611244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 691 | Open in IMG/M |
| 3300014658|Ga0181519_10978948 | Not Available | 525 | Open in IMG/M |
| 3300014969|Ga0157376_12081414 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300016294|Ga0182041_10802945 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300016341|Ga0182035_11214318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 674 | Open in IMG/M |
| 3300017988|Ga0181520_10803745 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300018014|Ga0187860_1198445 | Not Available | 824 | Open in IMG/M |
| 3300018037|Ga0187883_10628382 | Not Available | 558 | Open in IMG/M |
| 3300018062|Ga0187784_11554389 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300019278|Ga0187800_1492687 | Not Available | 650 | Open in IMG/M |
| 3300020580|Ga0210403_11243155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 571 | Open in IMG/M |
| 3300020583|Ga0210401_10908277 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300021171|Ga0210405_11202921 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021180|Ga0210396_11619729 | Not Available | 528 | Open in IMG/M |
| 3300021181|Ga0210388_10643911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300021420|Ga0210394_10995477 | Not Available | 726 | Open in IMG/M |
| 3300021477|Ga0210398_10596078 | Not Available | 897 | Open in IMG/M |
| 3300021478|Ga0210402_10243952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
| 3300022709|Ga0222756_1058230 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300022716|Ga0242673_1067975 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300025899|Ga0207642_10534158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300025913|Ga0207695_11326057 | Not Available | 600 | Open in IMG/M |
| 3300025916|Ga0207663_10065237 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300025918|Ga0207662_10602191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300025919|Ga0207657_11442889 | Not Available | 516 | Open in IMG/M |
| 3300025927|Ga0207687_10066469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2562 | Open in IMG/M |
| 3300025936|Ga0207670_10635161 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300025944|Ga0207661_11965232 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025960|Ga0207651_12009324 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025981|Ga0207640_12011196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300026035|Ga0207703_12410984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 502 | Open in IMG/M |
| 3300026095|Ga0207676_10580499 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300027826|Ga0209060_10016343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4031 | Open in IMG/M |
| 3300027869|Ga0209579_10431379 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027895|Ga0209624_10305567 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300027905|Ga0209415_10096533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3275 | Open in IMG/M |
| 3300027905|Ga0209415_10230716 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300027905|Ga0209415_11018622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 548 | Open in IMG/M |
| 3300028800|Ga0265338_10284998 | Not Available | 1206 | Open in IMG/M |
| 3300029915|Ga0311358_10263686 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300029989|Ga0311365_10968557 | Not Available | 735 | Open in IMG/M |
| 3300029999|Ga0311339_10379719 | Not Available | 1482 | Open in IMG/M |
| 3300030007|Ga0311338_10047715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5742 | Open in IMG/M |
| 3300030339|Ga0311360_11586184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 511 | Open in IMG/M |
| 3300030503|Ga0311370_12272904 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031234|Ga0302325_11070923 | Not Available | 1091 | Open in IMG/M |
| 3300031236|Ga0302324_101935112 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031524|Ga0302320_12057824 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031718|Ga0307474_10561809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031820|Ga0307473_10730333 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031897|Ga0318520_10283690 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300031910|Ga0306923_11298535 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031962|Ga0307479_11443391 | Not Available | 646 | Open in IMG/M |
| 3300032025|Ga0318507_10173686 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300032055|Ga0318575_10183221 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300032180|Ga0307471_103700934 | Not Available | 541 | Open in IMG/M |
| 3300032515|Ga0348332_13467374 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300032805|Ga0335078_10183490 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
| 3300032892|Ga0335081_12316532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300032895|Ga0335074_11163510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300032897|Ga0335071_12051283 | Not Available | 515 | Open in IMG/M |
| 3300033158|Ga0335077_10288113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1802 | Open in IMG/M |
| 3300033824|Ga0334840_090978 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009254 | Microbial communities of water from Amazon river, Brazil - RCM20 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1017385211 | 3300000364 | Soil | FSGKDRKTLYAVSRENATNKDWIIAIPMIAQGPKGRGK* |
| Ga0062386_1010848881 | 3300004152 | Bog Forest Soil | VFGSDGKYLGLIPTPRGIISVAFSALDRKTLYAVARDNAQNKDWIIAIQMIALGPKGRGK |
| Ga0068966_14309952 | 3300004476 | Peatlands Soil | PTPRGIISLAFSGPDRKTLYAVERENAENKDWIIAIQMIAQGPKGRGK* |
| Ga0062388_1014832491 | 3300004635 | Bog Forest Soil | NLGLIPTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK* |
| Ga0070680_1008315033 | 3300005336 | Corn Rhizosphere | GLIPTPRGLISVAFSGPDRKILYAVARENATNKDWIIGIQMISQGPKGRAK* |
| Ga0070673_1005265881 | 3300005364 | Switchgrass Rhizosphere | YLGVIPTPRPVITVTFSGPDRKTLYAVSRENATNKDWIIAIPMIAQGPKGRGK* |
| Ga0070681_106605233 | 3300005458 | Corn Rhizosphere | LGLIPTPRGLISVAFSGPDRKILYAVARENATNKDWIIGIQMISQGPKGRAK* |
| Ga0070731_101994391 | 3300005538 | Surface Soil | TDGRNLGLIPTPRDVISVTFSGPDRKTLYAVSRDNAQNKDWIIALDMIAHGPKGRGK* |
| Ga0070733_106796862 | 3300005541 | Surface Soil | DGKNLGVIPVPRDVISVTISGADHKTLYAVSRDTPLNKDWIIGIQLLAQGPKGRGK* |
| Ga0070686_1004033903 | 3300005544 | Switchgrass Rhizosphere | VISPDGKNLGMIPTPRGTITVTFGGPDRKTLYAVARDNAIDKDWIIALPMIAQGAKPRGK |
| Ga0068857_1016856872 | 3300005577 | Corn Rhizosphere | RPVITVTFSGKDRKTLYAVSRENATNKDWIIAIPMIAQGPKGRGK* |
| Ga0068854_1008263791 | 3300005578 | Corn Rhizosphere | DRKMLYAVARENATNKDWIIGIPLIAQGPKGRGK* |
| Ga0070761_107160173 | 3300005591 | Soil | KNLGVIPTPRGVITVTFSGPDRKTLYAVSRTGNTDWIIAIPMIAQGPKGRGK* |
| Ga0070702_1010072722 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | YLGVIPTPRPVISVTISGPDRKMLYAVSRDNATNKDWIIGLPLIAQGPKGRGK* |
| Ga0068852_1003824192 | 3300005616 | Corn Rhizosphere | IPTPRPVITVTFSGKDRKTLYAVSRENATNKDWIIAIPMIAQGPKGRGK* |
| Ga0068852_1009665951 | 3300005616 | Corn Rhizosphere | SATFSGPDRKTLYAVSRTGDTDWIIAIQMIAQGPKGRGK* |
| Ga0068864_1006026822 | 3300005618 | Switchgrass Rhizosphere | GVIPTPRPVITVTFSGPDRKTLYAVARENATNKDWIIAIPMIAQGPKGRGK* |
| Ga0068858_1004665492 | 3300005842 | Switchgrass Rhizosphere | LGVIPTPRPVITTTFSGPDRKTLYAVSRVGNTDWIIAIPMIAQGPKGRGK* |
| Ga0070766_104804412 | 3300005921 | Soil | SGPDRHTLYAVSRDNAQNKDWIIALQMIAQGPKGRGK* |
| Ga0075522_102854772 | 3300006638 | Arctic Peat Soil | VISVVFSGPDRKTLYAVSRDNAKNKDWIIAIQMIAQGPKGRGK* |
| Ga0079222_107050843 | 3300006755 | Agricultural Soil | IPTPRNIISVAFSGPNRKTLYVVARDNAMNKDWILTIPMIAQGAKGRGK* |
| Ga0079222_111054341 | 3300006755 | Agricultural Soil | PHPVISVAFSGPDRKVLYAVSRDNATNKDWIIAIQMISQGAKGRGK* |
| Ga0079220_119137791 | 3300006806 | Agricultural Soil | SVAFSGPDRKTLYAVARDNAQNKDWIIAIPMLAQGPKGRGK* |
| Ga0068865_1007855941 | 3300006881 | Miscanthus Rhizosphere | TFSGPDRKMLYAVSRDNALDKDWIIGIQMISQGPKDRGK* |
| Ga0073928_111966592 | 3300006893 | Iron-Sulfur Acid Spring | GPDRKMLYAVARDNAQNKDWILAIQMIAQGPKGRGK* |
| Ga0105240_105139952 | 3300009093 | Corn Rhizosphere | LGVIPTPRPVITVTFSGPDRKTLYAVSRTGNTDWIIAIPMLAQGPKGRGK* |
| Ga0105245_114150391 | 3300009098 | Miscanthus Rhizosphere | TFSGPDRKTLYAVSRDNATNKDWIIGIQMIAQGPKGRGK* |
| Ga0105243_103974172 | 3300009148 | Miscanthus Rhizosphere | ISGPDRKMLYAVSRDNATNKDWIIGLPLIAQGPKGRGK* |
| Ga0105241_105508234 | 3300009174 | Corn Rhizosphere | YGLISVSFSGPDRKMLYAVARENSTNKDWIIGIQMIAQGPKGRAK* |
| Ga0103858_100944791 | 3300009239 | River Water | YLGLIPTPRGIITVTFGGKDRKTMFVVARDNATNKDWILGIPTIAQGPKGRAK* |
| Ga0103867_10229063 | 3300009254 | River Water | VISPEGKYLGLIPTPRGIITVTFGGKDRKTMFVVARDNATNKDWILGIPTIAQGPKGRAK |
| Ga0116222_10549284 | 3300009521 | Peatlands Soil | RGIISVAFSGPDRKMLYAVSRDNAQNKDWIIGIQMIAQGPKGRGK* |
| Ga0126373_114811211 | 3300010048 | Tropical Forest Soil | GPDRKTLYVVARDNPSDKDWILGIPMIAQGPKVRGK* |
| Ga0126370_110503481 | 3300010358 | Tropical Forest Soil | NIISVAFSGPDRKTLYVVSRENALNKDWIIAIDMVAQGSKSRGK* |
| Ga0126378_126674022 | 3300010361 | Tropical Forest Soil | LGLIPTPRGIISVAFSGPDRKTLYVVARDNPSDKDWILGIPMIAQGPKVRGK* |
| Ga0134128_105088433 | 3300010373 | Terrestrial Soil | YLGMIPTPHPVISVAFSGPDRKVLYAVSRDNATNKDWIIAIQMISQGAKGRGK* |
| Ga0105239_105243873 | 3300010375 | Corn Rhizosphere | VITVTFSGPDRKTLYAVSRTGNTDWIIAMPMIAQGPKGRGK* |
| Ga0126381_1041526092 | 3300010376 | Tropical Forest Soil | PTPRGVISVAFSGPNRKTLYAVSRDNAQNKDWIIAIEMIAQGPKGRAK* |
| Ga0134124_102661483 | 3300010397 | Terrestrial Soil | FSGPDRKVLYAVSRDNATNKDWIIAIQMISQGAKGRGK* |
| Ga0164305_112576322 | 3300012989 | Soil | GKYLGVIPTPRPVITVTFSGKDRKTLYAVSRENATNKDWIIAIPMIAQGPKGRGK* |
| Ga0181521_105480411 | 3300014158 | Bog | TSSGGIQVIGPDGNNLGVIPTPRGVITVTISGPDRRTLYAVSNNQRNDWIMTIPLLAQGPKGRGK* |
| Ga0181531_102784351 | 3300014169 | Bog | TPRGVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIQTIAQGPKGRGK* |
| Ga0181537_102499241 | 3300014201 | Bog | GPDRKTLYAVARDNAQNKDWIIAIEMLAQGPKGRAK* |
| Ga0181537_109667201 | 3300014201 | Bog | PRDVISVAFSGPDRKTLYAVSRDNALNKDWIIAIQMIAQGPKGRGK* |
| Ga0075301_10832992 | 3300014262 | Natural And Restored Wetlands | IGGPDRKMLYAVTRDNAQNKDWVIGIPLIAQGPRGRGK* |
| Ga0182018_103368772 | 3300014489 | Palsa | RGLISVAFSGPDRRTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK* |
| Ga0182015_106112441 | 3300014495 | Palsa | LGLIPTPRDVISVAFSGPERKTLYAVSRDNAENKDWIIAIEMVAQGPKGRGK* |
| Ga0181519_109789481 | 3300014658 | Bog | GPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK* |
| Ga0157376_120814142 | 3300014969 | Miscanthus Rhizosphere | VITVTFSGPDRKMLYAVSRTGDTDWIIGIPMIAQGPKGRGK* |
| Ga0182041_108029451 | 3300016294 | Soil | GKVLGMIPTPRGVISVAFSGADRKTLYAVSRDNAQNKDWLIAIQMIAQGPKGRGK |
| Ga0182035_112143181 | 3300016341 | Soil | VAFSGPDRKTLYAVSRDNAQNKDWIIAIPMLAQGPKGRGK |
| Ga0181520_108037451 | 3300017988 | Bog | KNLGVIPTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK |
| Ga0187860_11984451 | 3300018014 | Peatland | SGPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK |
| Ga0187883_106283822 | 3300018037 | Peatland | PTPRDVISVAFSGPDRETLYAVSRDNAQNKDWIIAIPMIAQGPKGRGK |
| Ga0187784_115543891 | 3300018062 | Tropical Peatland | LIPTPRDVISVAFSGPDRKTLYAVSRDKAQNKDWIIALQMVAQGPKGRGK |
| Ga0187800_14926872 | 3300019278 | Peatland | ISLAFSGPDRKTLYAVERDNAENKDWIVAIPMIAQGPKGRGK |
| Ga0210403_112431552 | 3300020580 | Soil | LGIIPAPHGVISVTFSGKDRKTLYAVGREGGNQAPGNKAIILAIQMIAQGPKGRGK |
| Ga0210401_109082772 | 3300020583 | Soil | DGKNLGLIPTPRDVISVTFSGPDRKTLYAVSRDNAQNKDWIIAIQTIAQGPKGRGK |
| Ga0210405_112029211 | 3300021171 | Soil | LIPTPRGIISVAFSGPDRKMLYAVSRDNAQNKDWIIAIQTIAQGPKGRGK |
| Ga0210396_116197291 | 3300021180 | Soil | SGPDRKTLYAVSRDNAQNKDWIIAIETIAQGPKGRGK |
| Ga0210388_106439111 | 3300021181 | Soil | PTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIETVAQGPKGRGK |
| Ga0210394_109954772 | 3300021420 | Soil | PRPVLSVTFSGPGKKMLYAVSREGNSDWIIALPMITQGPKDRGK |
| Ga0210398_105960782 | 3300021477 | Soil | SVTFSGSDRKMLYAVSRDNGQNKDWIIALEMLAQGPKGRGK |
| Ga0210402_102439521 | 3300021478 | Soil | IPTPRGLISAAFSGPNGKMLYVVSRDNAQNKDWILGIQMISQGPKGRGK |
| Ga0222756_10582301 | 3300022709 | Soil | LIPTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIETTAQGPKGRGK |
| Ga0242673_10679751 | 3300022716 | Soil | ANLGLIPTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIEMIAQGPKGRGK |
| Ga0207642_105341583 | 3300025899 | Miscanthus Rhizosphere | IPTPRPVITVTFSGKDRKTLYAVSRDNATNKDWIIAIPMIAQGPKGRGK |
| Ga0207695_113260571 | 3300025913 | Corn Rhizosphere | VTFSGPDRKTLYAVSRTGNTDWIIAIPMLAQGPKGRGK |
| Ga0207663_100652371 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GKYLGLIPTPRGIISVAFSGQDRKTLYAVARDNAQNRDWIIAIQMIAQGPKGRAK |
| Ga0207662_106021912 | 3300025918 | Switchgrass Rhizosphere | YVTAQAAGIQVFDPTGKYLGVIPTPRPVISVTISGPDRKMLYAVSRDNATNKDWIIGLPLIAQGPKGRGK |
| Ga0207657_114428891 | 3300025919 | Corn Rhizosphere | GVITVTFSGKDKKTLYAVGREGGNTAPGNKAIIMTIPMIAQGPKGRGK |
| Ga0207687_100664692 | 3300025927 | Miscanthus Rhizosphere | MIPTPRGTITVTFGGPDRKTLYAVARDNAMDRDWIIALPMIAQGAKPRGK |
| Ga0207670_106351612 | 3300025936 | Switchgrass Rhizosphere | VITTTFSGPDRKTLYAVSRTGNTDWIIAIPMIAQGPKGRGK |
| Ga0207661_119652322 | 3300025944 | Corn Rhizosphere | TPRGIISAAFSGKDRKILYVVSRDNAQDKDWIIGIQMIAQGPKGRAK |
| Ga0207651_120093242 | 3300025960 | Switchgrass Rhizosphere | RAVITTTFSGPDRKTLYAVSRTGNTDWIIAIPMIAQGPKGRGK |
| Ga0207640_120111961 | 3300025981 | Corn Rhizosphere | ATFSGPDRKTLYAVSRTGDTDWIIAIQMIAQGPKGRGK |
| Ga0207703_124109842 | 3300026035 | Switchgrass Rhizosphere | AGIQVIGPDGKNLGVIPTPRGVISVTFSGPDRKMLYAVSRDNALDKDWIIGIQMISQGPKDRGK |
| Ga0207676_105804992 | 3300026095 | Switchgrass Rhizosphere | GVIPTPRPVITVTFSGPDRKTLYAVARENATNKDWIIAIPMIAQGPKGRGK |
| Ga0209060_100163437 | 3300027826 | Surface Soil | PRGLISVAFSGPNRKMLYVVSRDNAQDKDWILGIQMISQGPKGRGK |
| Ga0209579_104313791 | 3300027869 | Surface Soil | GTDGRNLGLIPTPRDVISVTFSGPDRKTLYAVSRDNAQNKDWIIALDMIAHGPKGRGK |
| Ga0209624_103055671 | 3300027895 | Forest Soil | NLGLIPTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIETIAQGPKGRGK |
| Ga0209415_100965333 | 3300027905 | Peatlands Soil | SGPDRKTLYAVSNNQRNDWIMTIPLLAQGPKGRGK |
| Ga0209415_102307161 | 3300027905 | Peatlands Soil | SGPDRKTLYAVSNNQRNDWIMTIPLMAQGPKGRGK |
| Ga0209415_110186222 | 3300027905 | Peatlands Soil | IPTPRNILSVTFSGPDRKMLYGVSREGDKDWIIGIQMIAQGPKGRGK |
| Ga0265338_102849982 | 3300028800 | Rhizosphere | TPRGVITVTFSGPDRKTLYAVSRTGNTDWIIAIPMIAQGPKGRGK |
| Ga0311358_102636861 | 3300029915 | Bog | PRGVISLAFSGPDRKTLYAVGRDGANNQDWILSIKTIAQGAKGRGK |
| Ga0311365_109685572 | 3300029989 | Fen | LGVIPTPRPVITTTFSGPDRKTLYAVSRVGNTDWIISIPMIAQGPKGRGK |
| Ga0311339_103797191 | 3300029999 | Palsa | RDVISVAFSGPDRKTLYAVSRDGAQNKDWIIAIETIAQGPKGRGK |
| Ga0311338_100477158 | 3300030007 | Palsa | VISVTFSGPDRKMLYAVSRDNGQNKDWIIALEMIAQGPKGRGK |
| Ga0311360_115861841 | 3300030339 | Bog | FSGPGRKTLYAVVRENATNKDWIISIPMLAQGAKGRGK |
| Ga0311370_122729042 | 3300030503 | Palsa | TPRDVISVTFSGPDRKMLYAVSRDNGQNKDWIIALEMIAQGPKGRGK |
| Ga0302325_110709231 | 3300031234 | Palsa | AFSGPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK |
| Ga0302324_1019351122 | 3300031236 | Palsa | PAPRAVLSITFSGADRKMLYAVARDTPQNKDWIIAIQTIAQGPKGRAK |
| Ga0302320_120578241 | 3300031524 | Bog | GSIPTPRGVISVAFSGPDRKVLYAVSRDNAQNKDWIIALQMIAQGPKGRGK |
| Ga0307474_105618092 | 3300031718 | Hardwood Forest Soil | PDRKTLYAVSRDNAQNKDWIIAIPMIAQGPKGRGK |
| Ga0307473_107303332 | 3300031820 | Hardwood Forest Soil | STNPGVQIIAPDGKYLGLIPTPRGIISLAFSGTNRNVLYAVARDNVQNKDWILAISTMSQGPKGRGK |
| Ga0318520_102836903 | 3300031897 | Soil | GPDRKTLYAVSRDNAQNKDWIIAIPMLAQGPKGRGK |
| Ga0306923_112985352 | 3300031910 | Soil | KYLGLIPTPRGVISVAFSGTDRKTLYAVSRDNAQNKDWIIAIKMLSQGPKGRGK |
| Ga0307479_114433913 | 3300031962 | Hardwood Forest Soil | PRPVITVTISGPDRKTLYAVNNDQRNDVIMTITLIAQGPKGRGK |
| Ga0318507_101736863 | 3300032025 | Soil | IISVAFSGPDRKTLYAVSRDNAQNKDWIIAIPMLAQGPKGRGK |
| Ga0318575_101832211 | 3300032055 | Soil | SGPDRKTLYAVSRDNAQNKDWIIAIPMLAQGPKGRGK |
| Ga0307471_1037009341 | 3300032180 | Hardwood Forest Soil | PRDVISVAFSWPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK |
| Ga0348332_134673741 | 3300032515 | Plant Litter | GTNLGLIPTPRDVISVAFSGPDRKTLYAVSRDNAQNKDWIIAIKMNAQGPKGRGK |
| Ga0335078_101834904 | 3300032805 | Soil | LGLIPTPRGLISVAFSGPNRKMLYAVSRDNAQNRDWIIAIQTIAQGPKGRGK |
| Ga0335081_123165321 | 3300032892 | Soil | GIISVAFSGPDRKTLYAVSRDNAQNKDWIIAIQMIAQGPKGRGK |
| Ga0335074_111635101 | 3300032895 | Soil | GLIPTPRDVISVAFSGPGRKTLYAVSRDNAQNKDWIIALPMIAQGPKGRGK |
| Ga0335071_120512831 | 3300032897 | Soil | GIISVAFSGPDRKTLYAVARENVQNKDWILAIQTIAQGPKGRGK |
| Ga0335077_102881133 | 3300033158 | Soil | GVISVAFSGPNRKTLYAVSRDNAQNKDWIIAIPMLAQGPKGRGK |
| Ga0334840_090978_2_115 | 3300033824 | Soil | AFSGKDRKTLYAVERQGADDWIISIPMIAQGPKGRGK |
| ⦗Top⦘ |