| Basic Information | |
|---|---|
| Family ID | F088780 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNIFKKIERGLTALAMAPLSGLEKKERERRLEERLKRSEQKHSHN |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.91 % |
| % of genes near scaffold ends (potentially truncated) | 15.60 % |
| % of genes from short scaffolds (< 2000 bps) | 78.90 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.798 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland (20.183 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.110 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.532 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 1.83 |
| PF13240 | zinc_ribbon_2 | 1.83 |
| PF02245 | Pur_DNA_glyco | 1.83 |
| PF13450 | NAD_binding_8 | 1.83 |
| PF00717 | Peptidase_S24 | 0.92 |
| PF14378 | PAP2_3 | 0.92 |
| PF09674 | DUF2400 | 0.92 |
| PF01391 | Collagen | 0.92 |
| PF07690 | MFS_1 | 0.92 |
| PF14791 | DNA_pol_B_thumb | 0.92 |
| PF02659 | Mntp | 0.92 |
| PF01965 | DJ-1_PfpI | 0.92 |
| PF13086 | AAA_11 | 0.92 |
| PF04304 | DUF454 | 0.92 |
| PF03372 | Exo_endo_phos | 0.92 |
| PF02566 | OsmC | 0.92 |
| PF00011 | HSP20 | 0.92 |
| PF14947 | HTH_45 | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF02156 | Glyco_hydro_26 | 0.92 |
| PF01243 | Putative_PNPOx | 0.92 |
| PF07362 | CcdA | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF13020 | NOV_C | 0.92 |
| PF04055 | Radical_SAM | 0.92 |
| PF01037 | AsnC_trans_reg | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 1.83 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.92 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.92 |
| COG1971 | Putative Mn2+ efflux pump MntP | Inorganic ion transport and metabolism [P] | 0.92 |
| COG2832 | Uncharacterized membrane protein YbaN, DUF454 family | Function unknown [S] | 0.92 |
| COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.92 |
| COG5302 | Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid | Mobilome: prophages, transposons [X] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.80 % |
| All Organisms | root | All Organisms | 42.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000317|WSSedL2TaDRAFT_1038070 | Not Available | 533 | Open in IMG/M |
| 3300000894|WSSedL1B2DRAFT_1010700 | All Organisms → cellular organisms → Archaea | 797 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100957953 | Not Available | 512 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101900791 | Not Available | 1203 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105203308 | Not Available | 1108 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105946481 | Not Available | 1303 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106172436 | Not Available | 813 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107108861 | Not Available | 712 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_110308607 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 972 | Open in IMG/M |
| 3300001547|JGI20215J15232_1014420 | All Organisms → cellular organisms → Archaea | 1117 | Open in IMG/M |
| 3300001547|JGI20215J15232_1059163 | Not Available | 505 | Open in IMG/M |
| 3300002961|JGI11641J44799_10007597 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3282 | Open in IMG/M |
| 3300002961|JGI11641J44799_10032022 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1550 | Open in IMG/M |
| 3300003432|JGI20214J51088_10063530 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2579 | Open in IMG/M |
| 3300003432|JGI20214J51088_10095216 | Not Available | 2095 | Open in IMG/M |
| 3300003432|JGI20214J51088_10305388 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1087 | Open in IMG/M |
| 3300003432|JGI20214J51088_10329546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300003432|JGI20214J51088_11185103 | Not Available | 502 | Open in IMG/M |
| 3300003541|JGI20214J51650_10166933 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1513 | Open in IMG/M |
| 3300004072|Ga0055512_10046975 | Not Available | 756 | Open in IMG/M |
| 3300004078|Ga0055513_10024189 | Not Available | 1113 | Open in IMG/M |
| 3300004282|Ga0066599_100785422 | All Organisms → cellular organisms → Archaea | 667 | Open in IMG/M |
| 3300005208|Ga0069003_10042549 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 748 | Open in IMG/M |
| 3300005217|Ga0069005_10163371 | Not Available | 604 | Open in IMG/M |
| 3300006640|Ga0075527_10132135 | Not Available | 700 | Open in IMG/M |
| 3300006950|Ga0075524_10000146 | All Organisms → cellular organisms → Archaea | 14769 | Open in IMG/M |
| 3300006950|Ga0075524_10049512 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1737 | Open in IMG/M |
| 3300006950|Ga0075524_10124190 | All Organisms → cellular organisms → Archaea → TACK group | 1112 | Open in IMG/M |
| 3300006950|Ga0075524_10160825 | Not Available | 974 | Open in IMG/M |
| 3300007896|Ga0111484_1041545 | All Organisms → cellular organisms → Archaea | 951 | Open in IMG/M |
| 3300007906|Ga0111482_1008702 | All Organisms → cellular organisms → Archaea | 2057 | Open in IMG/M |
| 3300007907|Ga0111546_105534 | All Organisms → cellular organisms → Archaea | 1166 | Open in IMG/M |
| 3300009029|Ga0066793_10325741 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 886 | Open in IMG/M |
| 3300009053|Ga0105095_10107154 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1517 | Open in IMG/M |
| 3300009091|Ga0102851_11428661 | Not Available | 769 | Open in IMG/M |
| 3300009179|Ga0115028_10734128 | Not Available | 759 | Open in IMG/M |
| 3300009179|Ga0115028_10754714 | Not Available | 751 | Open in IMG/M |
| 3300009406|Ga0116587_1061072 | All Organisms → cellular organisms → Archaea | 641 | Open in IMG/M |
| 3300010379|Ga0136449_100227574 | Not Available | 3497 | Open in IMG/M |
| 3300012931|Ga0153915_10191014 | Not Available | 2243 | Open in IMG/M |
| 3300012931|Ga0153915_12334146 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 626 | Open in IMG/M |
| 3300014153|Ga0181527_1109744 | Not Available | 1277 | Open in IMG/M |
| 3300014490|Ga0182010_10261573 | Not Available | 922 | Open in IMG/M |
| 3300014490|Ga0182010_10751216 | Not Available | 551 | Open in IMG/M |
| 3300014498|Ga0182019_10067921 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2106 | Open in IMG/M |
| 3300014498|Ga0182019_10779307 | Not Available | 683 | Open in IMG/M |
| 3300014502|Ga0182021_10014515 | All Organisms → cellular organisms → Archaea | 9357 | Open in IMG/M |
| 3300014502|Ga0182021_10060388 | Not Available | 4408 | Open in IMG/M |
| 3300014502|Ga0182021_10135690 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2860 | Open in IMG/M |
| 3300014502|Ga0182021_10149212 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2721 | Open in IMG/M |
| 3300014502|Ga0182021_10267587 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2006 | Open in IMG/M |
| 3300014502|Ga0182021_10719259 | All Organisms → cellular organisms → Archaea | 1198 | Open in IMG/M |
| 3300014502|Ga0182021_10813500 | Not Available | 1122 | Open in IMG/M |
| 3300014502|Ga0182021_10977055 | Not Available | 1019 | Open in IMG/M |
| 3300014502|Ga0182021_12310870 | Not Available | 647 | Open in IMG/M |
| 3300014502|Ga0182021_13533259 | Not Available | 520 | Open in IMG/M |
| 3300014839|Ga0182027_10127953 | All Organisms → cellular organisms → Archaea | 3018 | Open in IMG/M |
| 3300014839|Ga0182027_10838043 | Not Available | 958 | Open in IMG/M |
| 3300017925|Ga0187856_1088016 | All Organisms → cellular organisms → Archaea | 1259 | Open in IMG/M |
| 3300017939|Ga0187775_10077902 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1072 | Open in IMG/M |
| 3300017966|Ga0187776_11250109 | Not Available | 559 | Open in IMG/M |
| 3300017974|Ga0187777_10980317 | Not Available | 611 | Open in IMG/M |
| 3300017996|Ga0187891_1273656 | Not Available | 556 | Open in IMG/M |
| 3300018009|Ga0187884_10269044 | Not Available | 692 | Open in IMG/M |
| 3300018016|Ga0187880_1468028 | All Organisms → cellular organisms → Archaea | 519 | Open in IMG/M |
| 3300018018|Ga0187886_1085859 | Not Available | 1343 | Open in IMG/M |
| 3300018019|Ga0187874_10275043 | Not Available | 687 | Open in IMG/M |
| 3300018062|Ga0187784_10293700 | Not Available | 1320 | Open in IMG/M |
| 3300018085|Ga0187772_10136745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1610 | Open in IMG/M |
| 3300018086|Ga0187769_10179026 | Not Available | 1563 | Open in IMG/M |
| 3300018086|Ga0187769_10865499 | Not Available | 683 | Open in IMG/M |
| 3300018088|Ga0187771_11119243 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 668 | Open in IMG/M |
| 3300018090|Ga0187770_10069983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 | 2568 | Open in IMG/M |
| 3300018090|Ga0187770_11586353 | Not Available | 534 | Open in IMG/M |
| 3300019082|Ga0187852_1156312 | Not Available | 964 | Open in IMG/M |
| 3300025582|Ga0209386_1032652 | Not Available | 953 | Open in IMG/M |
| 3300025888|Ga0209540_10666331 | Not Available | 513 | Open in IMG/M |
| 3300025891|Ga0209585_10019248 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp. | 2470 | Open in IMG/M |
| 3300025891|Ga0209585_10092311 | Not Available | 1142 | Open in IMG/M |
| 3300025891|Ga0209585_10301354 | Not Available | 642 | Open in IMG/M |
| 3300025891|Ga0209585_10396063 | Not Available | 564 | Open in IMG/M |
| 3300026026|Ga0210129_1045776 | All Organisms → cellular organisms → Archaea | 799 | Open in IMG/M |
| 3300026350|Ga0256823_1005390 | All Organisms → cellular organisms → Archaea | 978 | Open in IMG/M |
| 3300027731|Ga0209592_1133655 | All Organisms → cellular organisms → Archaea → TACK group | 896 | Open in IMG/M |
| 3300027887|Ga0208980_10049828 | All Organisms → cellular organisms → Archaea | 2438 | Open in IMG/M |
| 3300027887|Ga0208980_10110573 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300027887|Ga0208980_10226645 | All Organisms → cellular organisms → Archaea | 1089 | Open in IMG/M |
| 3300027896|Ga0209777_10090563 | Not Available | 2629 | Open in IMG/M |
| 3300027896|Ga0209777_10542441 | Not Available | 851 | Open in IMG/M |
| 3300027896|Ga0209777_10641062 | All Organisms → cellular organisms → Archaea → TACK group | 763 | Open in IMG/M |
| 3300027896|Ga0209777_10713859 | Not Available | 712 | Open in IMG/M |
| 3300027896|Ga0209777_10767682 | All Organisms → cellular organisms → Archaea | 679 | Open in IMG/M |
| 3300027900|Ga0209253_10146746 | Not Available | 1911 | Open in IMG/M |
| 3300027905|Ga0209415_10800346 | Not Available | 657 | Open in IMG/M |
| 3300028060|Ga0255359_115089 | Not Available | 747 | Open in IMG/M |
| 3300030055|Ga0302173_10350193 | Not Available | 563 | Open in IMG/M |
| 3300030114|Ga0311333_11796154 | Not Available | 533 | Open in IMG/M |
| 3300031539|Ga0307380_11429091 | All Organisms → cellular organisms → Archaea → TACK group | 520 | Open in IMG/M |
| 3300032829|Ga0335070_10419838 | Not Available | 1277 | Open in IMG/M |
| 3300032893|Ga0335069_12433842 | Not Available | 543 | Open in IMG/M |
| 3300033408|Ga0316605_12336838 | Not Available | 520 | Open in IMG/M |
| 3300033487|Ga0316630_11871382 | Not Available | 549 | Open in IMG/M |
| 3300033557|Ga0316617_100009972 | Not Available | 4310 | Open in IMG/M |
| 3300034128|Ga0370490_0020512 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300034169|Ga0370480_0089292 | Not Available | 1064 | Open in IMG/M |
| 3300034195|Ga0370501_0051293 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 20.18% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 14.68% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 10.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.42% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.67% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 3.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.83% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.83% |
| Wetland | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland | 1.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.92% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000030 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk | Environmental | Open in IMG/M |
| 3300000317 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L2 Tule | Environmental | Open in IMG/M |
| 3300000894 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001547 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004078 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005208 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 | Environmental | Open in IMG/M |
| 3300005217 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300007906 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_1 | Environmental | Open in IMG/M |
| 3300007907 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_3 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009406 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_1 SPAdes | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300025582 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300026026 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026350 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6 | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028060 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T25 | Environmental | Open in IMG/M |
| 3300030055 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| WSSedB1B_0323332 | 3300000030 | Wetland | MEAKCFTNSLKKIERGLTALAIAPLSGLENKERDRRLEERLKRLDEKHSNK* |
| WSSedL2TaDRAFT_10380702 | 3300000317 | Wetland | LNALKKIERGLTALALAPLSGLEKKERNRRIEERLKRSEQKYRHN* |
| WSSedL1B2DRAFT_10107002 | 3300000894 | Wetland | EKYFMNLLRKIERGLTVLALAPLSGLEKKERDRRLDERLRRLEQKHNRN* |
| JGIcombinedJ13530_1009579531 | 3300001213 | Wetland | MNFIKKFGRGLSALALAPLSGLERKECNRRLEERLKRIEQKQRFN* |
| JGIcombinedJ13530_1019007912 | 3300001213 | Wetland | MKSIKKIERGLAALAMAPLVGLEKKERSRRLEERLKRSEQKHNQN* |
| JGIcombinedJ13530_1052033082 | 3300001213 | Wetland | MNALKKIGRTFSILAIASFSGLENKERNRRLEERLKRSEEKRKKV* |
| JGIcombinedJ13530_1059464814 | 3300001213 | Wetland | MNLFMKIERGLTVLALAPLSGLEKKARDRVLEERLKRLEQKYVYK* |
| JGIcombinedJ13530_1061724361 | 3300001213 | Wetland | MPKLFRKVSRGLTALAMAPLVDLENRKRDRRLEERIRRLEQRKISA* |
| JGIcombinedJ13530_1071088612 | 3300001213 | Wetland | MNLFRKIGRGLTVFAMAPLVGLETKERDRRLKERLKRCEEKRSNYAKT* |
| JGIcombinedJ13530_1103086071 | 3300001213 | Wetland | NLFRKIERGLTALAIAPLMGLERKGRDRKCEERIKRLEQKRNRNN* |
| JGI20215J15232_10144201 | 3300001547 | Wetland | KYLNLLRKIERGLTVLALAPLSGLEKKERDRRLDERLRRLEQKHNRN* |
| JGI20215J15232_10591631 | 3300001547 | Wetland | MNLFKKIERSLTILAMAPLVGLEGRERERRLEERLKRSXXXXNSFN* |
| JGI11641J44799_100075972 | 3300002961 | Wetland | MNLLRKIERGLTVLALAPLSGLEKKERDRRLDERLRRLEQKHNRN* |
| JGI11641J44799_100320221 | 3300002961 | Wetland | MNLFKKIERSLTILAMAPLVGLEGRERERRLEERLKRSQRKHNNFN* |
| JGI20214J51088_100635305 | 3300003432 | Wetland | MNLVKKLERSLAVIAMAPLVGLESKERERRLEERLKRSQQRHNFN* |
| JGI20214J51088_100952163 | 3300003432 | Wetland | VNSLKRIERGLTALALAPLSGLEKKERNRRLEERLKRSEQKYRHN* |
| JGI20214J51088_103053882 | 3300003432 | Wetland | MNSLKXIERGLTALALAPLSGLEKKERNRRIEERVKRSEQKYRHN* |
| JGI20214J51088_103295462 | 3300003432 | Wetland | MNLFKKIERGLTALAIAPLSGLERKERDRRLEERLRRLEQKQSYN* |
| JGI20214J51088_111851031 | 3300003432 | Wetland | MNLVKKLERSLTVIAMAPLVGLESKERERRLEERLKRSRQRHNFN* |
| JGI20214J51650_101669331 | 3300003541 | Wetland | MNSLKRIERGLTALALAPLSGLEKKERNRRIEERVKRSEQKYRHN* |
| Ga0055512_100469751 | 3300004072 | Natural And Restored Wetlands | MNSLKRIERGLTALALAPLSGLEKKERNRRIEERVKRSEQKYRHN*EKI |
| Ga0055513_100241891 | 3300004078 | Natural And Restored Wetlands | MNLFKKIERSLTILAMAPLVGLEGRERERRLEERLKRSRQRHNSFN* |
| Ga0066599_1007854221 | 3300004282 | Freshwater | NLLRKIERGLTVLALAPLSGLEKKERDRRLDERLRRLEQKHNRN* |
| Ga0069003_100425492 | 3300005208 | Natural And Restored Wetlands | MNSLKRIERGLTALALAPLSGLEKKERNRRIEERVKRSEQKYRHK* |
| Ga0069005_101633711 | 3300005217 | Natural And Restored Wetlands | VNSLKRIERGLTALALAPLSGLEKKERNRRLEERLKRSEQKHGHK* |
| Ga0075527_101321351 | 3300006640 | Arctic Peat Soil | MKSFKKIERGLTALAVAPLSGLEKKERDRRLEERLKRSEQKQSHK* |
| Ga0075524_100001469 | 3300006950 | Arctic Peat Soil | VNSVKKFKRGITALSIAPLSRLEKKERDGRLDERLKRLEQKQNK* |
| Ga0075524_100495121 | 3300006950 | Arctic Peat Soil | MSEAKYFMKSFKKIERGLTALAMAPLSGLEKKGRDRRLEERLKRSEQKQSHK* |
| Ga0075524_101241902 | 3300006950 | Arctic Peat Soil | MNLLKKIGRSLSAIALTPFSGLENRERNRRLEERLKRSEEKQKKL* |
| Ga0075524_101608252 | 3300006950 | Arctic Peat Soil | MNALKKIERSLTALALAPLSGLEKKERDRRLEERLKRSEQKHNHK* |
| Ga0111484_10415452 | 3300007896 | Sediment | MNLIKKFTRGLTVVAMAPLCGLENKERNRRLEERLKRIENRDLA* |
| Ga0111482_10087022 | 3300007906 | Sediment | MNLIKKFTWGLTVVAMAPLCGLENKERNRRLEERLKRIENRDLA* |
| Ga0111546_1055342 | 3300007907 | Sediment | MNLIKKFTWGLTVVAMAPLCGLENKERNRRLEDRLKRIENRDLA* |
| Ga0066793_103257412 | 3300009029 | Prmafrost Soil | MNLFRKIWRGLTALAMAPLSGLETRERDRRFEERLKRCEEKQKHLNSANN* |
| Ga0105095_101071541 | 3300009053 | Freshwater Sediment | MNLFRKIERGLTVLAIAPLSGLEKKERNRKLEERLKRLEQKQSYK* |
| Ga0102851_114286611 | 3300009091 | Freshwater Wetlands | MNLIKKMSRNLGALAMAPLVSLERKERERRLEERYKRIKKKEP* |
| Ga0115028_107341281 | 3300009179 | Wetland | LANLFKKLGRGLTALAMAPLVGLEKKETQRRIEERIKRSEQKIKRS* |
| Ga0115028_107547141 | 3300009179 | Wetland | MNLFRKIERGLTALAIAPLMGLEKKGRDRKCEERLKRLEQQRKRYN* |
| Ga0116587_10610721 | 3300009406 | Sediment | MNLIKKFTRGLTVVAMAPLCGLENKERNRRLEERLK |
| Ga0116108_11999582 | 3300009519 | Peatland | LDEKGERLFTNLLQRIRRGLLVLAIAPFYWLEKKELERKLEERLKRSEQK |
| Ga0136449_1002275741 | 3300010379 | Peatlands Soil | MNFFKKIERDLTVFAMAPLVELERRERERRLEERLKGSEEKH |
| Ga0153915_101910144 | 3300012931 | Freshwater Wetlands | MKLFKKIGRSLTVLALAPLSGLETRERDRRLEERLKRFEEKQKRLS* |
| Ga0153915_123341461 | 3300012931 | Freshwater Wetlands | MKLIKRIERGLVVLAMAPLVGLERKERDRRLEERLKRAEQRNK* |
| Ga0181527_11097443 | 3300014153 | Bog | MNLFKKVVRGFTVLAMAPLSGLERKERDRRLEERLKRIEEKQGRK* |
| Ga0182010_102615731 | 3300014490 | Fen | VNSLKKIERGLTALAMAPLSGLEKKERERRLEERLKRSEQKHRNN* |
| Ga0182010_107512161 | 3300014490 | Fen | MNLIKKIGRDFSVLAMAPLVGLERKERERRLDERLKRSEQKYSKN* |
| Ga0182019_100679213 | 3300014498 | Fen | MNLFRKFERGLTALAIAPFSGLEKKERDRRLEERLKRSEEKHGSK* |
| Ga0182019_107793071 | 3300014498 | Fen | VNSLKKIERGLTALAMAPLAGLEKKERERRLEERLKRSEQKHRNN* |
| Ga0182021_100145153 | 3300014502 | Fen | VNSLKKIERALTTIAIAPLSGLEKKERDRRLEERLKRLEQKSRRN* |
| Ga0182021_100603883 | 3300014502 | Fen | MNLLKKIGRALTVVAIAPLSGLENKGRNRKLEERLKHLEEKNRFA* |
| Ga0182021_101356901 | 3300014502 | Fen | VNSLKKIEQGLTALAMAPLAGLEKKERERRLEERLKRSEQKHR |
| Ga0182021_101492122 | 3300014502 | Fen | MNLFKKIERELSVLAMSPLVGLEKKERERRLEERLKRSEQKYSKR* |
| Ga0182021_102675873 | 3300014502 | Fen | MNILRKIGHGLTALAMAPLSRLETRERNRRFKERLKRCEEKQ |
| Ga0182021_107192591 | 3300014502 | Fen | MKSIKKIERGLAALAMAPLVGLEKKERSRRLEERLKRSEQKHIQN* |
| Ga0182021_108135002 | 3300014502 | Fen | MNLFKKIERSLTILAMAPLVGLEGRERERKLEERLKRSRQRHNFN* |
| Ga0182021_109770552 | 3300014502 | Fen | MNLFKKIERNLTILAMAPLVGLEGREREKRLEERLKRSRQRHNFN* |
| Ga0182021_123108702 | 3300014502 | Fen | MNLLRKIERGLTALAMAPLSGLDTRERDRRIEERIKRYEEKQKHLHSANN* |
| Ga0182021_135332592 | 3300014502 | Fen | MNLFKKIERGFTVLAMAPLVGLEKKERERRLEERFKRLAQKHIQN* |
| Ga0182027_101279535 | 3300014839 | Fen | MNIFKKIERGLTALAMAPLSGLEKKERERRLEERLKRSEQKHSHN* |
| Ga0182027_108380431 | 3300014839 | Fen | MFTNLFKKIERGLTVLAMAPLSGLEKKERERKLEERLKRSEEKHSRN |
| Ga0187856_10880161 | 3300017925 | Peatland | MNLFKKIGRGLTAVAMAPLYELEKKERERKLEERLKRAQKSRVASER |
| Ga0187775_100779022 | 3300017939 | Tropical Peatland | MKLFKRIERGFLSFALTPFYRLEIKERNRRLEERVKRSLQKQKRL |
| Ga0187776_112501091 | 3300017966 | Tropical Peatland | MNSLRKFGRNLTALAIAPLSMLEEKEKRRRLDERLRRSEQKGKH |
| Ga0187777_109803172 | 3300017974 | Tropical Peatland | MNVFRKIGRGLTVLAIAPLSELEKRERDRRLAERIKHLEEKNRFA |
| Ga0187891_12736561 | 3300017996 | Peatland | MNLFKKIERGLTVLALTPLSELERKERERRLEERLKRCEE |
| Ga0187884_102690441 | 3300018009 | Peatland | LNFFKRIERDLTVFAMAPLVELERKERERRLEERLKRSEQKHSSNN |
| Ga0187880_14680281 | 3300018016 | Peatland | MNLLKKIERDLTVLAMSPMVELEKKERERKLDERLKRIEQKHDLK |
| Ga0187886_10858594 | 3300018018 | Peatland | MNLFRKIERGLTALAMAPLVGLEKKERERILEERLKRSEEKHGCK |
| Ga0187874_102750432 | 3300018019 | Peatland | MNFFKKIERSFTVLAMAPLVELERKERERRLEERLKRSEQKHGNN |
| Ga0187784_102937002 | 3300018062 | Tropical Peatland | MNFLKKIGRSLTALAIAPLSGLEENERRRRLDERLKRLEQKQKHCTLAHS |
| Ga0187772_101367451 | 3300018085 | Tropical Peatland | MNFFKKVERELAALVIAPFYGLERKERERRLEERLKRSGQKKKH |
| Ga0187769_101790261 | 3300018086 | Tropical Peatland | MNFFKKVERELAALVIAPFYGLERKERERRLEERLKRSEQKKNQ |
| Ga0187769_108654991 | 3300018086 | Tropical Peatland | MNFLKKIGRSLTALAVAPLSGLEEKERRKRLDERLKRD |
| Ga0187771_111192432 | 3300018088 | Tropical Peatland | MNFFKKVERELAALAIAPLSGLERKERERRLEERLKRSGQKKKH |
| Ga0187770_100699834 | 3300018090 | Tropical Peatland | MNLFKRIEQGLTTLAMAPLSELEKKERKRRLEERLKRIEEKQDHK |
| Ga0187770_115863531 | 3300018090 | Tropical Peatland | MNFLKKIGRSLTALAIAPLSGLEEKERRRRLDERLKRLEQKQKH |
| Ga0187852_11563121 | 3300019082 | Peatland | MNLFKKVVRGFTVLAMAPLSGLERKERDRILEERLKRLEQKQKHSARA |
| Ga0209386_10326521 | 3300025582 | Arctic Peat Soil | MNALKKIERSLTALALAPLSGLEKKERDRRLEERLKRSEQKHNHK |
| Ga0209540_106663311 | 3300025888 | Arctic Peat Soil | MNLFRKIERGLTALAIAPLSGLEKKERDRRLEERLKRLEQKHKCN |
| Ga0209585_100192481 | 3300025891 | Arctic Peat Soil | VNSVKKFKRGITALSIAPLSRLEKKERDGRLDERLKRLEQKQNK |
| Ga0209585_100923111 | 3300025891 | Arctic Peat Soil | MSEAKYFMKSFKKIERGLTALAMAPLSGLEKKGRDRRLEERLKRSEQKQSHK |
| Ga0209585_103013542 | 3300025891 | Arctic Peat Soil | MNLLKKIGRSLSAIALTPFSGLENRERNRRLEERLKRSEEKQKKL |
| Ga0209585_103960632 | 3300025891 | Arctic Peat Soil | MNALKKIERSLTALALAPLSGLEKKERDRRLEERLKRSEQKHNPK |
| Ga0210129_10457761 | 3300026026 | Natural And Restored Wetlands | MNLFKKIERSLTILAMAPLVGLEGRERERRLEERLKRSRQRHNSFN |
| Ga0256823_10053901 | 3300026350 | Sediment | MNLLRKIERGLTVLALAPLSGLEKKERDRRLDERLRRLEQKRNRN |
| Ga0209592_11336551 | 3300027731 | Freshwater Sediment | MNLFRKIERGLTVLAIAPLSGLEKKERNRKLEERLKRLEQKQSYK |
| Ga0208980_100498283 | 3300027887 | Wetland | IERGLTVLALAPLSGLEKKERDRRLDERLRRLEQKHNRN |
| Ga0208980_101105733 | 3300027887 | Wetland | NALKKIERGLTALALAPLSGLEKKERNRRIEERLKRSEQKYRHN |
| Ga0208980_102266451 | 3300027887 | Wetland | MNLFKKIERSLTILAMAPLVGLEGRERARRLEERLKRSQRKHNNFN |
| Ga0208980_104359351 | 3300027887 | Wetland | MNYFRKIERGLTALALVPFSNLETKERKRRLDERLMRLEQRQKDHEQRNKK |
| Ga0209777_100905635 | 3300027896 | Freshwater Lake Sediment | MNVFKKIERGITVLAMAPLFELEKKEREKRLEERLKRCKEK |
| Ga0209777_105424412 | 3300027896 | Freshwater Lake Sediment | MNFFKKIERSFTVLAMAPLVGLEKKERERRLEERLKRAEQKHRSN |
| Ga0209777_106410622 | 3300027896 | Freshwater Lake Sediment | MNLLKKIGRTFSILAIASFSGLENKERNRRLEERLKRSEEKRKKV |
| Ga0209777_107138591 | 3300027896 | Freshwater Lake Sediment | MNSLKKIERGLTVVAMAPFVGLEKKERERRLDERLKRLENKSIVSSEG |
| Ga0209777_107676821 | 3300027896 | Freshwater Lake Sediment | MNLFKKIERSLTILAMAPLVGLEGRERERRLEERLKRLQQKHNFN |
| Ga0209253_101467464 | 3300027900 | Freshwater Lake Sediment | MNLFRKIGRGITVLAIVPLSGLEKKERDRRLDERLKRLEQKEKNLCSNNS |
| Ga0209415_108003461 | 3300027905 | Peatlands Soil | MNFFKKIERDLTIFAMAPLVELERKERERRLEERLKGREE |
| Ga0255359_1150891 | 3300028060 | Soil | VNSLKKIEQGLTALAMAPLAGLEKKERDRRLEERLKRSEQKHGHD |
| Ga0302173_103501931 | 3300030055 | Fen | VNSLKKIERALTTIAIAPLSGLEKKERDRRLEERLKRLEQKSRRN |
| Ga0311333_117961541 | 3300030114 | Fen | MVMSLFRKIRRRLTVIAMAPLSGLENKQRNRKLEERLKRSEQKNSYR |
| Ga0307380_114290911 | 3300031539 | Soil | MNLFRKIERSLTAFVMAPLSGLEKRERDRRLEERLKRSEQKRSKIENFVS |
| Ga0335070_104198382 | 3300032829 | Soil | MKRIVKIERFLTALAMAPLVQLEHRERERKLEERLKRAQHKYE |
| Ga0335069_124338422 | 3300032893 | Soil | MNLFKKIERSLTILAMAPLVGLEGRERERRLEERLKRSRQKHNDFN |
| Ga0316605_123368381 | 3300033408 | Soil | GLTVLALAPLVGLEKKARDRVLEERLKRLEQKHVYK |
| Ga0316630_118713822 | 3300033487 | Soil | MNLFKKIERGFTVLALTPLVGLEHRERERRIEERLKRLQQKHNFN |
| Ga0316617_1000099723 | 3300033557 | Soil | MNLIKKMSRNLGALAMAPLVSLERKERERRLEERYKRIKKKEP |
| Ga0370490_0020512_1192_1305 | 3300034128 | Untreated Peat Soil | MSRNLGALAMAPLVSLERKERERRLEERYKRIKKKEP |
| Ga0370480_0089292_688_828 | 3300034169 | Untreated Peat Soil | MNLIQRIGRSLSVLALAWFSGLENKERDRRLEERFKRSEEKRKNKL |
| Ga0370501_0051293_1027_1170 | 3300034195 | Untreated Peat Soil | MIMSLFRKIRRRLILIAMAPLSGLENKERNRKIEERLKRSEQKHNYR |
| ⦗Top⦘ |