| Basic Information | |
|---|---|
| Family ID | F088750 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MFDDKTIVRMTIVYEDGSMTILKKEKDGRLSVERREK |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.07 % |
| % of genes near scaffold ends (potentially truncated) | 8.26 % |
| % of genes from short scaffolds (< 2000 bps) | 60.55 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.211 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (57.798 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.908 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.248 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.15% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 57.80 |
| PF04679 | DNA_ligase_A_C | 4.59 |
| PF04675 | DNA_ligase_A_N | 3.67 |
| PF00899 | ThiF | 2.75 |
| PF00004 | AAA | 1.83 |
| PF02229 | PC4 | 1.83 |
| PF06067 | DUF932 | 1.83 |
| PF14520 | HHH_5 | 0.92 |
| PF01336 | tRNA_anti-codon | 0.92 |
| PF03104 | DNA_pol_B_exo1 | 0.92 |
| PF12826 | HHH_2 | 0.92 |
| PF08271 | TF_Zn_Ribbon | 0.92 |
| PF00136 | DNA_pol_B | 0.92 |
| PF10055 | DUF2292 | 0.92 |
| PF12705 | PDDEXK_1 | 0.92 |
| PF13361 | UvrD_C | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 57.80 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 8.26 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.21 % |
| All Organisms | root | All Organisms | 46.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 57.80% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.01% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.50% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.83% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.83% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.92% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.92% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006726 | Marine viral communities from Cariaco Basin, Caribbean Sea - 28_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_1000061613 | 3300000115 | Marine | MFDDKTIERMTIVYTDGSMTILTKNKDGTMSVQRREK* |
| DelMOSum2011_101392623 | 3300000115 | Marine | MFDGDIVRMTIVYADGSMSILVKEDDGRLRIERRKK* |
| JGI25128J35275_10169023 | 3300002488 | Marine | LGDDMFDDKTIVRMTIVYEDGSITILKKNKDGTLSVERRET* |
| JGI25128J35275_10837352 | 3300002488 | Marine | MRLSVDDKEIVRMTIVYADGSMTILVKEKNGTLSVERRGR* |
| Ga0078893_143885681 | 3300005837 | Marine Surface Water | DDKEIVRMTIVYKDGSMTILKREKNGMLSVDRRQK* |
| Ga0098070_1037312 | 3300006726 | Marine | MDDKEIVRMTIVYKDGSMTILTKNEDGTMKTERRQK* |
| Ga0098038_10106276 | 3300006735 | Marine | MMFDDKEIVRMTIVYKDGSMTILTKNDDGTLSVDRREMR* |
| Ga0098038_10926103 | 3300006735 | Marine | MFDDKEIVRMTIVYKDGSMTILTKNDDGTLSVDRREK* |
| Ga0098038_11427644 | 3300006735 | Marine | KMFDDKDIVRITIVYADGSMTILKRKGDSLMSVERREKT* |
| Ga0098037_10154043 | 3300006737 | Marine | MFDDKDIVRITIVYADGSMTILKRKGDSLMSVERREKT* |
| Ga0098037_12607032 | 3300006737 | Marine | MDKQIVRMTIVYADGTMTILVKGDDGKLSVERRER*NAQSAKKKL |
| Ga0098042_100000363 | 3300006749 | Marine | MNMFDDKTIVRMTIVYEDGSMTILTKNDDGTLAVQRREK* |
| Ga0098042_10072685 | 3300006749 | Marine | MFDDKEIVRMTIVYQDGSMTILIREGNLFKIERRQGKNDRRL* |
| Ga0098048_10262598 | 3300006752 | Marine | IEMLDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKS* |
| Ga0098048_10503622 | 3300006752 | Marine | MLNDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRQKS*KRKQLQ* |
| Ga0098054_10430392 | 3300006789 | Marine | MDKQIVRMTIVYADGTMTILVKGDDGKLSVERRER* |
| Ga0098054_12163492 | 3300006789 | Marine | MLDDKDIVRMTIVYKDGSMTILVKGKDGKLSVERRQKR* |
| Ga0098055_100091032 | 3300006793 | Marine | MLNDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRQKS* |
| Ga0070749_1000229826 | 3300006802 | Aqueous | MFDDKTIVRMTIVYEDGSMTILKKEKDGRLSVERREK* |
| Ga0070748_13601931 | 3300006920 | Aqueous | MLDKEIVRMTIVYEDGNMTILTKNKDGTMSVQRREK* |
| Ga0098060_10105836 | 3300006921 | Marine | MLDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRKSN* |
| Ga0098060_10107742 | 3300006921 | Marine | MNMLDDKDIVRMTIVYKDGSMTILIKGKDGKLSVERRQKS* |
| Ga0098050_10013521 | 3300006925 | Marine | IMDKQIVRMTIVYADGTMTILVKGDDGKLSVERR* |
| Ga0098041_100045522 | 3300006928 | Marine | MFDDKDIVRMTIVYKDGSMTILIKQSDGTLKVERREK* |
| Ga0098036_10316212 | 3300006929 | Marine | VHLGDNMFDDKTIVRMTIVYEDGSITILKKNKDGAMSVERREV* |
| Ga0098036_10913672 | 3300006929 | Marine | MLDDKDIVRMTIVYKDGSMTILIKGKDGKLSVERRQKS* |
| Ga0098036_11655612 | 3300006929 | Marine | MLDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKS* |
| Ga0075468_101009402 | 3300007229 | Aqueous | MRMLDKEIVRMTIVYEDGNMTILTKNKDGTMSVQRREK* |
| Ga0070752_10770962 | 3300007345 | Aqueous | MNMFDDKTIVRMTIVYEDGSMTILKKEKDGRLSVERREK* |
| Ga0099849_10186863 | 3300007539 | Aqueous | MFDDKTIVRMTIVYEDGSMTILTKNKDGTMKVQRREK* |
| Ga0102817_11465062 | 3300007555 | Estuarine | MKMNVDDKSIVRMTIVYADGSMTILVKEADGSLSVERR |
| Ga0102825_11361612 | 3300007655 | Estuarine | MKMNVDDKSIVRMTIVYADGSMTILVKEADGSLSVERRER* |
| Ga0118730_11322362 | 3300009132 | Marine | MFEDKNIVRMTIVYEDGSMTILTKNEDGSMTVKRREK* |
| Ga0114994_101084202 | 3300009420 | Marine | MNMFDDKKIERMTIVYEDGSMTILIRQKNGNMTVDRRPA* |
| Ga0114997_100282505 | 3300009425 | Marine | MFDDKTIVRMTIVYEDGSMTILKKTKQGMSVERKESK* |
| Ga0114997_101713894 | 3300009425 | Marine | MVNLDDKDIERMTIVYTDGSMTILLKGKDGKLSIKRRPAI* |
| Ga0115545_10020112 | 3300009433 | Pelagic Marine | MVNLNDKDIERMTIVYTDGSMTILRKGKDGKLSIDRRPAQ* |
| Ga0115545_10996623 | 3300009433 | Pelagic Marine | MIDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKS* |
| Ga0115545_11801802 | 3300009433 | Pelagic Marine | MNMLDKNIVRMTIVYEDGSMTILTKNKDGSMSVQRREK* |
| Ga0115100_107710292 | 3300009608 | Marine | MIDDKDIVRMTIVYKDGSMTILKKEKNGMLSVDRREKP* |
| Ga0115012_120459932 | 3300009790 | Marine | MFDDKEIVRMTIVYKDGSMTILTKNKDGTLNVDRREK* |
| Ga0098043_100009240 | 3300010148 | Marine | MFDDKEIVRMTIVYQDGSMTILIREGNSFKIERRQGKNDRRL* |
| Ga0098043_100109111 | 3300010148 | Marine | MFDDKKIVRMTIVYEDGSMTILTKNEDGSMAVQRREK* |
| Ga0098043_10546112 | 3300010148 | Marine | MIDNKDIVRMTIVYADGSMTILIKNKDGTLKVERRQK* |
| Ga0098056_10347041 | 3300010150 | Marine | MIDDKDIVRMTIVYKDGSMTILIKQSDGTLKVERRNK* |
| Ga0098059_10784732 | 3300010153 | Marine | MNMLDDKEIVRMTIVYKDGSMTILKRKGDSLMSVERREKK* |
| Ga0151674_10091212 | 3300011252 | Marine | MIDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRQK* |
| Ga0160423_101777902 | 3300012920 | Surface Seawater | MLDDKDIVRMTIVYADGSMTILVKNKDGTLKVERRQK* |
| Ga0160423_107516231 | 3300012920 | Surface Seawater | MFDDKDIVRMTIVYADGSMTILVKNKDGTLKVERRQK* |
| Ga0163110_102391522 | 3300012928 | Surface Seawater | MFDDKEIKSMTIVYTDGSTTILTKNKDGSMTVQRREK* |
| Ga0163110_117958512 | 3300012928 | Surface Seawater | MLGDKDIVRMTIVYADGSMTILVKNKDGTLKVERRQK* |
| Ga0181372_10496292 | 3300017705 | Marine | MFDDKDIVRITIVYADGSMTILKRKGDSLMSVERREKT |
| Ga0181377_10844052 | 3300017706 | Marine | MIDNKDIVRMTIVYADGSMTILVKNKDGTLKVERRQKPXKRKQSQ |
| Ga0181403_10158753 | 3300017710 | Seawater | MFDDKTIERMTIVYTDGSMTILTKNKDGTMSVQRREK |
| Ga0181419_10990003 | 3300017728 | Seawater | VFDDKDIVRMTIVYKDGSMIILKKEMNGMLSVDSR |
| Ga0181415_10329092 | 3300017732 | Seawater | MIDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKPXKRKQLQ |
| Ga0181421_10287992 | 3300017741 | Seawater | VFDDKDIVRMNIVYKDGSMIILKKEKNGMLSVDRREKP |
| Ga0181392_12247062 | 3300017749 | Seawater | MIDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKP |
| Ga0181385_10614373 | 3300017764 | Seawater | MIDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRKSN |
| Ga0181406_10264293 | 3300017767 | Seawater | MIDDKDIVRMTIVYADGSMTILVRDGNVMRIERRQK |
| Ga0181567_102914612 | 3300018418 | Salt Marsh | MFEDKTIVRMTIVYEDGCMTILKKEKDGRLSVERREK |
| Ga0211532_100045541 | 3300020403 | Marine | MLDDKEIVRMTIVYKDGTMTILKKEKNGMLSVERREK |
| Ga0211532_100356066 | 3300020403 | Marine | MNMFDDKEIVRMTIVYKDGSMTILTKNKDGTLNVDRREK |
| Ga0211668_100989942 | 3300020406 | Marine | MFDDKEIVRMTIVYKDGSMTILTKNKDGTLSVNRRQG |
| Ga0211523_1000391613 | 3300020414 | Marine | MFEDKTITRMTIVYEDGSLTILTKNKDGTMNVERREVK |
| Ga0211528_101758902 | 3300020417 | Marine | MFDDKTIVRMTIVYEDGSMTILTKNTDGTMKVQRREK |
| Ga0211653_101828861 | 3300020421 | Marine | MFDDKTIVRMTIVYEDGSITILKKNKDGAMSVERR |
| Ga0211708_102759411 | 3300020436 | Marine | MIDNKDIVRMTIVYADGSMTILVKNKDGTLKVERRQK |
| Ga0211614_100968341 | 3300020471 | Marine | MFDDKEIVRMTIVYKDGAMTILTKNDDGTLSVDRREMK |
| Ga0213858_102617792 | 3300021356 | Seawater | MFDDKTIIRMTIVYEDGSMTILKKEKDGSLSVERREK |
| Ga0196901_10130268 | 3300022200 | Aqueous | MFDDKTIVRMTIVYEDGSMTILKKEKDGRLSVERREK |
| Ga0255773_102515942 | 3300022925 | Salt Marsh | MFDDKTIVRMTIVYEDGSMTILTKNKDGTMKVQRREK |
| Ga0208792_10147512 | 3300025085 | Marine | MLNDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRQKS |
| Ga0208157_10820251 | 3300025086 | Marine | MFDDKEIVRMTIVYKDGSMTILTKNDDGTLSVDRREK |
| Ga0208434_10800202 | 3300025098 | Marine | MLNDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRRQKSXKRKQLQ |
| Ga0208669_100131813 | 3300025099 | Marine | MNMLDDKDIVRMTIVYKDGSMTILIKGKDGKLSVERRQKS |
| Ga0208669_10250104 | 3300025099 | Marine | MLDDKDIVRMTIVYKDGSMTILIKGKDGKLSVERRQKS |
| Ga0208159_100020438 | 3300025101 | Marine | MNMFDDKTIVRMTIVYEDGSMTILTKNDDGTLAVQRREK |
| Ga0208159_100146715 | 3300025101 | Marine | MMFDDKEIVRMTIVYKDGSMTILTKNDDGTLSVDRREMR |
| Ga0208158_100016010 | 3300025110 | Marine | MFDDKDIVRMTIVYKDGSMTILIKQSDGTLKVERREK |
| Ga0209349_10188838 | 3300025112 | Marine | LKINDKDIERMTIVYVDGSMTILIKGKDGKLKVSRRPAQ |
| Ga0209348_10980412 | 3300025127 | Marine | MFEDKDIVRMTIVYKDGSMTILVRDGNVMKIERRQR |
| Ga0208919_10105022 | 3300025128 | Marine | MFDDKTIVRMTIVYEDGSITILKKNKDGAMSVERREV |
| Ga0209232_100012547 | 3300025132 | Marine | MFDDKTIVRMTIVYEDGSITILKKNKDGTLSVERRET |
| Ga0209232_10005036 | 3300025132 | Marine | MMFDDKTIVRMTIVYEDGSMTILTKNDDGTLAVQRREK |
| Ga0209232_100053442 | 3300025132 | Marine | MLDDKDIVRMTIVYKDGSMIILKKEKDGSMSVDRRQKS |
| Ga0209232_100205716 | 3300025132 | Marine | MFDDKKIARMTIVYEDGSMTILTKNEDGSMAVQRREK |
| Ga0209232_10048898 | 3300025132 | Marine | MRLSVDDKEIVRMTIVYADGSMTILVKEKNGTLSVERRGR |
| Ga0209232_10051117 | 3300025132 | Marine | MFDDKEIVRMTIVYKDGSMTILTKNKDGTLSVDRREKR |
| Ga0209232_12384742 | 3300025132 | Marine | MFDDKTIVRMTIVYEDGSMTILTKNNDGTMKVQRREK |
| Ga0209336_100523552 | 3300025137 | Marine | MFDDKTIVRMTIVYEDGSMTILKKEKDGTMSVDRRTDS |
| Ga0209645_100006038 | 3300025151 | Marine | MFDDKTIVRMTIVYEDGSMTILKKEKDGSMSVDRREKS |
| Ga0209645_100778410 | 3300025151 | Marine | MFDDKKITRMTIVYEDGSMTILTKNEDGSMAVQRREK |
| Ga0209645_10096533 | 3300025151 | Marine | MFDDKTIERMTIVYEDGSMTILTKNKDGTMKVQRREK |
| Ga0209645_10138933 | 3300025151 | Marine | MIDNKDIVRMTIVYADGSMTILIKEKDGTLKVERRQK |
| Ga0209645_10212529 | 3300025151 | Marine | MLDDKDIVRMTIVYKDGSMTILVRDGNVMRIERRQK |
| Ga0209645_10438214 | 3300025151 | Marine | MFDDKDIVRMTIVYADGSMTILVKNKDGTLKVERRQK |
| Ga0209645_10504032 | 3300025151 | Marine | MFDDKEIVRMTIVYKDGTMTILKKEKNGMLSVERREK |
| Ga0209645_11886252 | 3300025151 | Marine | MLDDKDIVRMTIVYADGSMTILIKEKDGTLKVERRQK |
| Ga0209337_100463313 | 3300025168 | Marine | MFDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKS |
| Ga0209337_12213802 | 3300025168 | Marine | MFDGDIVRMTIVYADGSMSILVKEDDGRLKVERRKK |
| Ga0209194_11266993 | 3300025632 | Pelagic Marine | MIDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKS |
| Ga0209090_100425843 | 3300027813 | Marine | MNMFDDKKIERMTIVYEDGSMTILIRQKNGNMTVDRRPA |
| Ga0183683_100003537 | 3300029309 | Marine | MFDDKTIVRMTIVYEDGSMTILIKNDDGTLSVDRREMK |
| Ga0183748_10115454 | 3300029319 | Marine | MFDDKEIVRMTIVYKDGSMTILTKNDDGTLSVDRRQK |
| Ga0183755_10003967 | 3300029448 | Marine | VIDNKDIVRMTIVYADGSMTILVKGKDGKLSVERRQKR |
| Ga0307488_100491342 | 3300031519 | Sackhole Brine | MFDDKKIKRMTIVYEDGSMTILIKQDDGRYTYERRPV |
| Ga0315320_108039652 | 3300031851 | Seawater | VFDDKDIVRMTIVYKDGSMIILKKEKNGMLSVDRREKP |
| Ga0315316_104910822 | 3300032011 | Seawater | VRIGGIKMLNDKDIVRMTIVYKDGSMTILTKNKDGTLSVDRRQKS |
| ⦗Top⦘ |