| Basic Information | |
|---|---|
| Family ID | F088748 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCL |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 12.84 % |
| % of genes near scaffold ends (potentially truncated) | 97.25 % |
| % of genes from short scaffolds (< 2000 bps) | 85.32 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (57.798 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (18.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.945 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.954 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.47% β-sheet: 13.16% Coil/Unstructured: 72.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01510 | Amidase_2 | 26.61 |
| PF08123 | DOT1 | 6.42 |
| PF13385 | Laminin_G_3 | 5.50 |
| PF05105 | Phage_holin_4_1 | 4.59 |
| PF04860 | Phage_portal | 1.83 |
| PF01844 | HNH | 1.83 |
| PF05732 | RepL | 1.83 |
| PF13539 | Peptidase_M15_4 | 0.92 |
| PF13847 | Methyltransf_31 | 0.92 |
| PF03382 | DUF285 | 0.92 |
| PF09374 | PG_binding_3 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 4.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.91 % |
| Unclassified | root | N/A | 10.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876001|none_p093445 | All Organisms → Viruses | 527 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10065302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1344 | Open in IMG/M |
| 3300000928|OpTDRAFT_10393594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300000949|BBAY94_10039755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300000949|BBAY94_10045848 | All Organisms → Viruses | 1216 | Open in IMG/M |
| 3300001963|GOS2229_1035608 | All Organisms → Viruses | 1884 | Open in IMG/M |
| 3300001965|GOS2243_1058264 | All Organisms → Viruses | 759 | Open in IMG/M |
| 3300002098|JGI24219J26650_1014121 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300002161|JGI24766J26685_10015443 | All Organisms → Viruses → Predicted Viral | 1983 | Open in IMG/M |
| 3300002408|B570J29032_109870826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
| 3300003277|JGI25908J49247_10003954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4733 | Open in IMG/M |
| 3300005527|Ga0068876_10034498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3139 | Open in IMG/M |
| 3300005581|Ga0049081_10145205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300005581|Ga0049081_10340208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 510 | Open in IMG/M |
| 3300005824|Ga0074474_1611057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300005825|Ga0074476_1769662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300006734|Ga0098073_1011690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1461 | Open in IMG/M |
| 3300006802|Ga0070749_10702164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300006919|Ga0070746_10008703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 5830 | Open in IMG/M |
| 3300007545|Ga0102873_1082357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300007560|Ga0102913_1279642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300007593|Ga0102918_1155088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300007618|Ga0102896_1097606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300007621|Ga0102872_1163835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300007981|Ga0102904_1006555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2496 | Open in IMG/M |
| 3300008261|Ga0114336_1218416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300008448|Ga0114876_1217716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300008450|Ga0114880_1172178 | Not Available | 756 | Open in IMG/M |
| 3300009037|Ga0105093_10154544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
| 3300009085|Ga0105103_10695855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300009135|Ga0118736_10091457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 826 | Open in IMG/M |
| 3300009169|Ga0105097_10411933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300009170|Ga0105096_10147775 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
| 3300009488|Ga0114925_10591025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300009593|Ga0115011_11454134 | All Organisms → Viruses | 603 | Open in IMG/M |
| 3300009790|Ga0115012_11962329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300010312|Ga0102883_1139104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300010389|Ga0136549_10414470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300014811|Ga0119960_1017454 | Not Available | 868 | Open in IMG/M |
| 3300017714|Ga0181412_1062789 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 919 | Open in IMG/M |
| 3300017729|Ga0181396_1117988 | Not Available | 546 | Open in IMG/M |
| 3300017776|Ga0181394_1089367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300017778|Ga0181349_1100369 | All Organisms → Viruses | 1084 | Open in IMG/M |
| 3300017779|Ga0181395_1235980 | Not Available | 562 | Open in IMG/M |
| 3300017785|Ga0181355_1384093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 510 | Open in IMG/M |
| 3300019784|Ga0181359_1205780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 630 | Open in IMG/M |
| 3300020151|Ga0211736_10351513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300020220|Ga0194119_10692348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 616 | Open in IMG/M |
| 3300020450|Ga0211641_10540052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300021365|Ga0206123_10439888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300022198|Ga0196905_1194070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300022407|Ga0181351_1271506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 515 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10137574 | Not Available | 590 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10062847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1165 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10160496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10030038 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1577 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10015339 | All Organisms → Viruses → Predicted Viral | 2675 | Open in IMG/M |
| 3300024334|Ga0228671_1151025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300024343|Ga0244777_10315260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10020271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2352 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10245760 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 824 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10006588 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3107 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10420908 | Not Available | 549 | Open in IMG/M |
| 3300025099|Ga0208669_1011359 | Not Available | 2470 | Open in IMG/M |
| 3300025732|Ga0208784_1225773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 542 | Open in IMG/M |
| 3300027084|Ga0208443_1000792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8685 | Open in IMG/M |
| 3300027121|Ga0255074_1006792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300027127|Ga0255071_1024107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 943 | Open in IMG/M |
| 3300027142|Ga0255065_1016371 | All Organisms → Viruses → Predicted Viral | 1485 | Open in IMG/M |
| 3300027151|Ga0255063_1021164 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300027151|Ga0255063_1071530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300027156|Ga0255078_1005799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3024 | Open in IMG/M |
| 3300027217|Ga0208928_1011042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1499 | Open in IMG/M |
| 3300027217|Ga0208928_1026278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300027219|Ga0208167_1033119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300027220|Ga0208927_1046255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300027226|Ga0208309_1000895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3558 | Open in IMG/M |
| 3300027235|Ga0208804_1011295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300027244|Ga0208173_1057822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300027258|Ga0208558_1002351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2604 | Open in IMG/M |
| 3300027259|Ga0208178_1023076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1156 | Open in IMG/M |
| 3300027261|Ga0208933_1027888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300027525|Ga0208437_1002224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5481 | Open in IMG/M |
| 3300027582|Ga0208971_1066417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 924 | Open in IMG/M |
| 3300027659|Ga0208975_1019871 | All Organisms → Viruses → Predicted Viral | 2214 | Open in IMG/M |
| 3300027732|Ga0209442_1281338 | Not Available | 582 | Open in IMG/M |
| 3300027762|Ga0209288_10306623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300027792|Ga0209287_10369014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10204247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10239884 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 844 | Open in IMG/M |
| 3300027899|Ga0209668_10870237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10164936 | All Organisms → Viruses | 921 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10076802 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
| 3300028129|Ga0228634_1029525 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1551 | Open in IMG/M |
| 3300029306|Ga0135212_1011817 | Not Available | 790 | Open in IMG/M |
| 3300029308|Ga0135226_1015705 | Not Available | 659 | Open in IMG/M |
| 3300029345|Ga0135210_1042373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300029635|Ga0135217_108930 | All Organisms → Viruses | 622 | Open in IMG/M |
| 3300029753|Ga0135224_1036986 | Not Available | 537 | Open in IMG/M |
| 3300031746|Ga0315293_10292657 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300031758|Ga0315907_10395144 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300031951|Ga0315904_10967992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300031963|Ga0315901_11100314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300032088|Ga0315321_10072375 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED214 | 2376 | Open in IMG/M |
| 3300032277|Ga0316202_10100989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
| 3300033557|Ga0316617_101818930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300034101|Ga0335027_0100443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2209 | Open in IMG/M |
| 3300034167|Ga0335017_0475973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 665 | Open in IMG/M |
| 3300034374|Ga0348335_063000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.35% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.26% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 7.34% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.50% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.59% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 4.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.67% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.75% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.83% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.83% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.92% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.92% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.92% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.92% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.92% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.92% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.92% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.92% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.92% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876001 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027220 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027226 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027235 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027258 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
| 3300029308 | Marine harbor viral communities from the Indian Ocean - SRB2 | Environmental | Open in IMG/M |
| 3300029345 | Marine harbor viral communities from the Indian Ocean - SCH1 | Environmental | Open in IMG/M |
| 3300029635 | Marine harbor viral communities from the Indian Ocean - SMH2 | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_0934452 | 2236876001 | Marine Estuarine | NIHELRLEGTHAKIAMMSDLHWDNPKCDWKQLKQDLDYCLKESIPYYD |
| DelMOSum2011_100653024 | 3300000115 | Marine | MKIEQHEKNVHVLKLEGNKCQIAMLSDLHWDNPKCDW |
| OpTDRAFT_103935941 | 3300000928 | Freshwater And Marine | MIVKKHAKNIHEIQLEGELVKIAMLSDLHWDNPKSDWKILKRDLDY |
| BBAY94_100397551 | 3300000949 | Macroalgal Surface | MILKKHAKNIHEIQMDGKQVKIAMLSDIHWDNPKCDWRLLKRDL |
| BBAY94_100458483 | 3300000949 | Macroalgal Surface | MEIIKHASNIHELKLIGSRAKIAMLSDIHWDNPKCNWDLLKNDLNYCLKESIP |
| GOS2229_10356081 | 3300001963 | Marine | MKLIKHADNIHELKLDGTRAKIAMLSDIHWDNPKCDWKLLKNDLDFCLDNSIP |
| GOS2243_10582641 | 3300001965 | Marine | MKLIKHADNIHELKLAGTKARIAMFSDLHWDNPKCDWKLLKKDLDYCVKESIPIH |
| JGI24219J26650_10141213 | 3300002098 | Lentic | MNLIKHXKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKRDLDYCLKN |
| JGI24766J26685_100154431 | 3300002161 | Freshwater And Sediment | MNIVKHAKNIHEIQVKGCKAKIAMLSDIHWDNPKCDWNLLKRDLDYCVSENIPIM |
| B570J29032_1098708265 | 3300002408 | Freshwater | MLIKHSKNIHELQLTGKNVQIAMMSDLHWDNPKCDWDLLKRDFDYCLENDIK |
| JGI25908J49247_100039549 | 3300003277 | Freshwater Lake | MLKKHSKNIHELHIDGATVQLAMMSDLHWDNPKCDWDLLKRDFDYCLENDIK |
| Ga0068876_100344987 | 3300005527 | Freshwater Lake | MNVIKYAKNVHEIKLEGYNARIAMLSDIHWDNPKCDWDLLKKHLDYCVSE |
| Ga0049081_101452051 | 3300005581 | Freshwater Lentic | MKVTKHTKNIHELCLEGKHVQVAMLSDIHWDNPKCDWDYLKRHLDYCVKE |
| Ga0049081_103402082 | 3300005581 | Freshwater Lentic | MNLIKHAKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLN |
| Ga0074474_16110571 | 3300005824 | Sediment (Intertidal) | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKL |
| Ga0074476_17696621 | 3300005825 | Sediment (Intertidal) | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKL |
| Ga0098073_10116901 | 3300006734 | Marine | MTIIEHAENIHELQIDGTKTKIAMLSDIHWDNPKCDWKLLKKDLDYCLQE |
| Ga0070749_107021642 | 3300006802 | Aqueous | MNLIKHAKNVHELKVEGPEFRMAMLSDLHWDNPKCDWNLLKKDLDYCVSE |
| Ga0070746_100087031 | 3300006919 | Aqueous | MKLIKHAKNIHEVKLEGTHAKIAMLSDLHWDNPKCDWKLLKQDLDYC |
| Ga0102873_10823573 | 3300007545 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMIN |
| Ga0102913_12796422 | 3300007560 | Estuarine | MILKKHSKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIP |
| Ga0102918_11550883 | 3300007593 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLL |
| Ga0102896_10976063 | 3300007618 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEH |
| Ga0102872_11638352 | 3300007621 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLL |
| Ga0102904_10065551 | 3300007981 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYC |
| Ga0114336_12184161 | 3300008261 | Freshwater, Plankton | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNI |
| Ga0114876_12177163 | 3300008448 | Freshwater Lake | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRD |
| Ga0114880_11721781 | 3300008450 | Freshwater Lake | MLTKISKNVHVLKTQGKEIKIAMLSDIHWDNPKCDWDY |
| Ga0105093_101545443 | 3300009037 | Freshwater Sediment | MILKKHAKNIHELQLEGNLVKIAMLSDIHWDNPKSDWNILKRD |
| Ga0105103_106958551 | 3300009085 | Freshwater Sediment | MKVTKSTKNIHVLSLQGKHVEIAMLSDIHWDNPKCDWNYL |
| Ga0118736_100914571 | 3300009135 | Marine Sediment | MKLITHATNIHELKLQGTRAKIAMLSDIHWDNPKCDWKLLKNDLD |
| Ga0105097_104119331 | 3300009169 | Freshwater Sediment | MNVIKHAKNIHEIKLEGMDVKIAMLSDLHWDNPKCDW |
| Ga0105096_101477755 | 3300009170 | Freshwater Sediment | MNLIKHSKNVHELKVEGPEFRMAMLSDLHWDNPKCDWDLL |
| Ga0114925_105910254 | 3300009488 | Deep Subsurface | MKLIKHADNIHELKLDGTRAKIAMLSDIHWDNPKCDRKLLKNDL |
| Ga0115011_114541341 | 3300009593 | Marine | MKIIEHARNIHQLRLEGTHAKIAMLSDIHWDNPKCDWKQLKKDLNYCVK* |
| Ga0115012_119623292 | 3300009790 | Marine | MKLIKHAKNIHELKLEGTQAKIAMMSDLHWDNPKCDWKQLKQDLDYCKIRIN* |
| Ga0102883_11391041 | 3300010312 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIP |
| Ga0136549_104144702 | 3300010389 | Marine Methane Seep Sediment | MEIIKHAENIHEIKVDGTKTRIAMLSDIHWDNPKCDWKLLK |
| Ga0119960_10174543 | 3300014811 | Aquatic | MELIKHAKNIHELKITGTKVKIGMFSDIHWDNPK* |
| Ga0181412_10627893 | 3300017714 | Seawater | MEIIKHASNIHELKLSGTKAKIAMLSDIHWDNPKCNWDLLKNDLNYCLKESIPIHING |
| Ga0181396_11179882 | 3300017729 | Seawater | MEIIKHASNIHELKLTGSRAKIAMLSDIHWDNPKCNWD |
| Ga0181394_10893671 | 3300017776 | Seawater | MKLIKHASNIHELRLEGTHAKIAMMSDLHWDNPKCDWKQL |
| Ga0181349_11003693 | 3300017778 | Freshwater Lake | MNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYC |
| Ga0181395_12359803 | 3300017779 | Seawater | MKLIKHAGNIHELRLEGTHAKIAMMSDLHWDNPKCDWKQLKQ |
| Ga0181355_13840931 | 3300017785 | Freshwater Lake | MNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDFCLKNEIPIMFN |
| Ga0181359_12057801 | 3300019784 | Freshwater Lake | MNLIKHAKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCL |
| Ga0211736_103515133 | 3300020151 | Freshwater | MTVKKHAKNIHELNLIGKKVKIAMLSDIHWDNPKCDWNQLKK |
| Ga0194119_106923482 | 3300020220 | Freshwater Lake | MNLIKHANNIHELRVDGTLFKLGMFSDIHWDNPKCDWAL |
| Ga0211641_105400521 | 3300020450 | Marine | MRELKKINMKLIEHANNIHELKLEGNKARIAMFSDIHWDNPKCDWKLLKKDLDYCIK |
| Ga0206123_104398881 | 3300021365 | Seawater | MEITKHAKNIHELKLVGTHAKIAMLSDLHWDNPKCDWT |
| Ga0196905_11940701 | 3300022198 | Aqueous | MIVKKHAKNIHEIQLDGKQVKIAMLSDIHWDNPKCDWKLLKRDLDYCVDNQI |
| Ga0181351_12715061 | 3300022407 | Freshwater Lake | MNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCL |
| (restricted) Ga0233404_101375743 | 3300022913 | Seawater | MKLIKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKDLD |
| (restricted) Ga0233411_100628471 | 3300023112 | Seawater | MKLIKHAKNIHELKLDGTHAKIAMLSDLHWDNPKCDWKILKKDLDYCVKES |
| (restricted) Ga0233411_101604962 | 3300023112 | Seawater | MKLEQHEKNVHVLKLEGNKCQIAMLSDLHWDNPKCDWKLL |
| (restricted) Ga0233410_100300381 | 3300023276 | Seawater | MKLTKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKK |
| (restricted) Ga0255039_100153391 | 3300024062 | Seawater | MKLIKHAKNIHELKLEGTHAKIAMLSDLHWDNPKCDWKLL |
| Ga0228671_11510253 | 3300024334 | Seawater | MKLIKHANNIHELRLVGTHVKIAMMSDLHWDNPKCDWKQLKKDLD |
| Ga0244777_103152601 | 3300024343 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMING |
| (restricted) Ga0255046_100202713 | 3300024519 | Seawater | MEIIKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKDLDY |
| (restricted) Ga0255046_102457601 | 3300024519 | Seawater | MKLTKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKDLDY |
| (restricted) Ga0255045_100065881 | 3300024528 | Seawater | MKLIKHAGNIHELKLEGTHAKIAMFSDLHWDNPKCDWKILKKDL |
| (restricted) Ga0255045_104209081 | 3300024528 | Seawater | MKLIKHAKNIHELKLEGSHVKIGMFSDIHWDNPKCDWTIL |
| Ga0208669_10113591 | 3300025099 | Marine | MKIKAHAANIHEIKLEGTKARIAMLSDIHWDNPKC |
| Ga0208784_12257731 | 3300025732 | Aqueous | MNLIKHAKNIHELRVEGTSFRMGMFSDIHWDNPKCDWNL |
| Ga0208443_100079214 | 3300027084 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMIN |
| Ga0255074_10067921 | 3300027121 | Freshwater | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVM |
| Ga0255071_10241071 | 3300027127 | Freshwater | MNLIKHAKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLNNEIPIMFN |
| Ga0255065_10163714 | 3300027142 | Freshwater | MNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLNNEIPIMFNGDT |
| Ga0255063_10211644 | 3300027151 | Freshwater | MNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLK |
| Ga0255063_10715301 | 3300027151 | Freshwater | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLE |
| Ga0255078_10057996 | 3300027156 | Freshwater | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLK |
| Ga0208928_10110424 | 3300027217 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMIT |
| Ga0208928_10262783 | 3300027217 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIP |
| Ga0208167_10331191 | 3300027219 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCL |
| Ga0208927_10462551 | 3300027220 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPV |
| Ga0208309_10008951 | 3300027226 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHN |
| Ga0208804_10112953 | 3300027235 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLE |
| Ga0208173_10578221 | 3300027244 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPV |
| Ga0208558_10023511 | 3300027258 | Estuarine | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDW |
| Ga0208178_10230763 | 3300027259 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKR |
| Ga0208933_10278881 | 3300027261 | Estuarine | MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLK |
| Ga0208437_100222411 | 3300027525 | Estuarine | MIVKKHAKNIHEIQLEGELVKIAMLSDLHWDNPKSDWKILK |
| Ga0208971_10664171 | 3300027582 | Marine | MKLIKHAKNIHELKLEGSHAKIAMFSDIHWDNPKCDWTIL |
| Ga0208975_10198715 | 3300027659 | Freshwater Lentic | MNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLNNEIPIMFNGD |
| Ga0209442_12813382 | 3300027732 | Freshwater Lake | MELIKHSKNVHELLLEGKKVQLAVLSDLHWDNPKCDWKLLQKDLDYCLDKKIPV |
| Ga0209288_103066231 | 3300027762 | Freshwater Sediment | MILKKHAKNIHELQLDGNLVKIAMLSDLHWDNPKSDWKI |
| Ga0209287_103690141 | 3300027792 | Freshwater Sediment | MILKKHAKNIHEIQLEGELVKIAMLSDLHWDNPKSDWKLLK |
| (restricted) Ga0233415_102042471 | 3300027861 | Seawater | MEIIKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKD |
| (restricted) Ga0233415_102398843 | 3300027861 | Seawater | MKLTKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWS |
| Ga0209668_108702372 | 3300027899 | Freshwater Lake Sediment | MELIKHSKNVHVLKLHGKSVKIAMLSDIHWDNPKCD |
| (restricted) Ga0233413_101649361 | 3300027996 | Seawater | MKVIRHAKNVHEIQLEGKYAEMAMLSDLHWDNPKCDQDLLK |
| (restricted) Ga0233414_100768021 | 3300028045 | Seawater | MKLIKHAKNIHELKLEGTHAKIAMLSDLHWDNPKCDWKLLKKDLDYCLK |
| Ga0228634_10295251 | 3300028129 | Seawater | MKLIKHAGNIHELKLQGTHAKIAMFSDLHWDNPKCDWTILK |
| Ga0135212_10118171 | 3300029306 | Marine Harbor | MEIVKHEENIHEIKLHGTHTKIAMLSDIHWDNLDAIVTGK |
| Ga0135226_10157051 | 3300029308 | Marine Harbor | MKLIKHADNIHELKLDGTRAKIAMLSDIHWDNPKQIVTGK |
| Ga0135210_10423732 | 3300029345 | Marine Harbor | MKLIKHSENIHELKLDGTRAKIAMLSDIHWDNPKCDWKLFLF |
| Ga0135217_1089302 | 3300029635 | Marine Harbor | MEIVKHEENIHEIKLHGTHTKIAMLSDIHWDNPKCDWELLKKDLDYCVQESIPIMINA |
| Ga0135224_10369861 | 3300029753 | Marine Harbor | MKLIKHADNIHELKLDGTRAKIAMLSDIHWDTPDRDWE |
| Ga0315293_102926573 | 3300031746 | Sediment | MNLIKHEKNIHELRVDGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLKNEIPIMFNGD |
| Ga0315907_103951443 | 3300031758 | Freshwater | MNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLKN |
| Ga0315904_109679921 | 3300031951 | Freshwater | MIFKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLENNIPVMI |
| Ga0315901_111003141 | 3300031963 | Freshwater | MNVIKHAKNIHEIKLEGTKASIAMLSDIHWDNPKCDWNLLKKHLDYCVSEN |
| Ga0315321_100723751 | 3300032088 | Seawater | MEIIKHAKNIHELRLIGTHAKIAMFSDIHWDNPKC |
| Ga0316202_101009891 | 3300032277 | Microbial Mat | MKIEQHEKNVHVLKLKGNKCQIAMLSDLHWDNPKCDWKL |
| Ga0316617_1018189302 | 3300033557 | Soil | MKIIKHAKNVHELKVEGPEFRMAMLSDLHWDNPKCDWDLLKKDLDYC |
| Ga0335027_0100443_2083_2208 | 3300034101 | Freshwater | MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKR |
| Ga0335017_0475973_2_133 | 3300034167 | Freshwater | MNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWGLLKHDL |
| Ga0348335_063000_1216_1344 | 3300034374 | Aqueous | MTITKHADNIHELHLDGTKTRIAMLSDIHWDNPKCDWKLLKKD |
| ⦗Top⦘ |