 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F088716 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRGSFTYHDLMYKISHEDLEILNKIIKDNIETTEKTRMPLI |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.90 % |
| % of genes near scaffold ends (potentially truncated) | 15.60 % |
| % of genes from short scaffolds (< 2000 bps) | 64.22 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (84.404 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.101 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.798 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.239 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF12322 | T4_baseplate | 5.50 |
| PF07230 | Portal_Gp20 | 2.75 |
| PF12850 | Metallophos_2 | 0.92 |
| PF03900 | Porphobil_deamC | 0.92 |
| PF07554 | FIVAR | 0.92 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 84.40 % |
| All Organisms | root | All Organisms | 15.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.10% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 8.26% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.34% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.50% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.50% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.67% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.67% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.75% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.75% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.75% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.75% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.75% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.83% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.83% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.83% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.92% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.92% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.92% |
| Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
| 3300001970 | Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033 | Environmental | Open in IMG/M |
| 3300002131 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003409 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300014042 | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) | Host-Associated | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016736 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022833 | Saline water microbial communities from Ace Lake, Antarctica - #292 | Environmental | Open in IMG/M |
| 3300022839 | Saline water microbial communities from Ace Lake, Antarctica - #337 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100068838 | 3300000101 | Marine | MRGSFSYENLMYHTSHEDREILNKIIKDNIETTEKTKLPLL* |
| DelMOSum2010_100144644 | 3300000101 | Marine | MRGSISYNELMYNISRDDIEIYNKIIKDNIETTEKTNLPLL* |
| DelMOSum2010_100349042 | 3300000101 | Marine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIDATEKTRMPLI* |
| SI34jun09_10mDRAFT_10588932 | 3300000224 | Marine | MRGSFTYENLMYHTTVEDREILNKIIKDNIETTEKTKMPLL* |
| LP_A_09_P04_10DRAFT_10419382 | 3300000265 | Marine | MRGSLTYKDLMYHISNDDMEIFQNIIKDNIDATEKTRMPLI* |
| OpTDRAFT_100811152 | 3300000928 | Freshwater And Marine | MRGGISYTDLMYHISHDDLEIFNKIIADNIETVEKTKLPLL* |
| BpDRAFT_104877422 | 3300000930 | Freshwater And Marine | MVYERITYXXXLMYHISNDDMEIFQNIIKDNIDATEKTRMPLI* |
| GOS2248_100894222 | 3300001970 | Hypersaline | MRGSLTYQDIMYHISYEDVEILNKIIKDNIETTEKTKLALL* |
| M2t2BS1_13956372 | 3300002131 | Marine | MRGSFTYDDLMYKISHEDLEVLNQIIKENIETTEKTRMPLL* |
| M2t2BS2_107059202 | 3300002144 | Marine | MRGSLSYTDLMYRISYEDLEIFNNIIKDNIETTEKTRMPLL* |
| JGI26079J46598_10319932 | 3300003216 | Marine | MRGSINYIDLMYHISHDDLEIFNRIIKDNIETTEKTRLPLL* |
| JGI26081J50195_10046453 | 3300003346 | Marine | MRGSFTYSDLMYKISHEDLEILNRIIKDNIETTEKTRMPLI* |
| JGI26088J50261_10124473 | 3300003409 | Marine | MRGAMSYDDLFFKISFEDREIMNAIVKDNIETTNKTKMPLI* |
| JGI26086J50260_10595332 | 3300003410 | Marine | MRGSITYKDLMYNISRDDIEIFNNIIKDNIDATEKTRLPLI* |
| JGI26260J51721_10446042 | 3300003580 | Marine | MRGSMSYHDLMYKISTDDLEIFNKIIQDNLETVEKTKLPLL* |
| Ga0055584_1002330072 | 3300004097 | Pelagic Marine | MRGSISYYELMHVITNEDREVFYKIIKENIETVEKTKMPLL* |
| Ga0055584_1002709902 | 3300004097 | Pelagic Marine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIETTEKTRMPLI* |
| Ga0074647_10017613 | 3300005611 | Saline Water And Sediment | MRGSMTYHDLMHTISADDREIFSKIIKENIELVEKTKLPLL* |
| Ga0075478_100104983 | 3300006026 | Aqueous | MRGSMTYHDLMHTISADDREIFGKIIKENIETVEKTKLPLL* |
| Ga0098048_100022915 | 3300006752 | Marine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIEATEKTKLPLI* |
| Ga0098055_10065402 | 3300006793 | Marine | MRGSLTYKDLMYHISNDDMEIFNNIIKDNIDATEKTRMPLI* |
| Ga0075476_103358022 | 3300006867 | Aqueous | MRGSLTYKDLMYHISNEDMEIFRNIIKDNIDATEKTRMPLI* |
| Ga0075481_101216562 | 3300006868 | Aqueous | MRGSLTYKDLMYHITNDDMEIFNNIIKDNIDATEKTKMPLI* |
| Ga0102945_10076552 | 3300007609 | Pond Water | MRGSITYQNLMYNITRDDIEILNNIIKDNIEATEKTRLPLI* |
| Ga0102945_10227071 | 3300007609 | Pond Water | TYQNLMYNITRDDIEILNNIIKDNIEATEKTRLPLV* |
| Ga0102960_11831331 | 3300009000 | Pond Water | MRGSISYQDLMYSISREDIEIFNNIIKDNIEATEKTRLPLI* |
| Ga0102963_13649752 | 3300009001 | Pond Water | RGSISYYELMHVITNEDREIFYKIIKENIETVEKTKLPLL* |
| Ga0102814_106883441 | 3300009079 | Estuarine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIEATEKTRMPLI* |
| Ga0114995_100407612 | 3300009172 | Marine | MRGSISYNELMYDISRDDIEIYNKIIKDNIETTEKTNLPLL* |
| Ga0114995_100521792 | 3300009172 | Marine | MRGSITYHELMHVITNEDREVFYKIIKENIETVEKTKMPLL* |
| Ga0114995_100755472 | 3300009172 | Marine | MRGSFGYHDLMYKISNDDIEVMNNIIKDNIEATEKTKMPLI* |
| Ga0114995_100798072 | 3300009172 | Marine | MRGSFSYHDLMYKISNDDIGIMNNIIKDNIEATEKTKMPLI* |
| Ga0114994_100641273 | 3300009420 | Marine | MRGSFTYHDLMYKISHEDLEILNKIIKDNIETTEKTRMPLI* |
| Ga0114994_100885053 | 3300009420 | Marine | MRGSFSYENLMYHTSIEDREILNKIIKDNIETTEKTRMPLI* |
| Ga0114994_102676582 | 3300009420 | Marine | MRGSFTYDDLMYKITSEDLEILNQIVKDNIETTEKTRLPLM* |
| Ga0114994_107360562 | 3300009420 | Marine | MRGSMSYHDLMYKISRDDIEVFDRIIKDNIETTEKTRMPLI* |
| Ga0115008_100164862 | 3300009436 | Marine | MRGSINYDALMHHITRDDIDIFQRIIKDNIETTEKTRMPLI* |
| Ga0115007_108957591 | 3300009441 | Marine | MRGSMAYHDLMYKISRDDIEVFDRIIKDNIETTEKTRMPLI* |
| Ga0115571_12056741 | 3300009495 | Pelagic Marine | MRGSMSYHDLMYKISSDDLEIFNKIIQDNLDTVEKTKLPLL* |
| Ga0115572_100511422 | 3300009507 | Pelagic Marine | MRGSMSYHDLMYKISTDDLEIFNKIIQDNLDTVEKTKLPLL* |
| Ga0133547_117293461 | 3300010883 | Marine | MRGSISYNELMYDISRDDIEIYNKIIKDNIETTEKTNL |
| Ga0129353_15899332 | 3300012525 | Aqueous | RGSMTYHDLMHTISADDREIFGKIIKENIETVEKTKLPLL* |
| Ga0163110_115643122 | 3300012928 | Surface Seawater | MRGAFSYHDLMYKISVDDLEILNKIIKDNIETTEKTRLPLV* |
| Ga0163109_100156394 | 3300012936 | Surface Seawater | MRGSFSYHDLMYKITSEDLEILNKIIKENIETVEKTRLPLL* |
| Ga0163109_100913062 | 3300012936 | Surface Seawater | MRGSISYHDLMYKISNDDLELFNRIIKENIETTEKTRLPLL* |
| Ga0117790_10425922 | 3300014042 | Epidermal Mucus | MRGSMTYQDLMYKVSADDIEIFTRIIKDNIEATKESKLPLI* |
| Ga0182042_12160972 | 3300016733 | Salt Marsh | YMRGSISYIDLMYHISHEDLEIYNRIIKDNIETTEKTRMPLL |
| Ga0182049_11764181 | 3300016736 | Salt Marsh | ISYIDLMYHISHEDLEIYNRIIKDNIETTEKTRMPLL |
| Ga0181410_10143102 | 3300017763 | Seawater | MRGSISYHELMHVITNEDREVFYKIIKENIETVEKTKLPLL |
| Ga0181394_12550512 | 3300017776 | Seawater | MRGSISYYELMHVITNEDREIFYKIIKENIETVEKTK |
| Ga0181565_106284512 | 3300017818 | Salt Marsh | MRGSFTYENLMYHISVEDRDILNKIVKDNIETTEKTRMPLV |
| Ga0181584_1000019215 | 3300017949 | Salt Marsh | MRGSVTYEDLMFNISHEDIEIFNNIIKENIEMTEKARMPLL |
| Ga0181607_100362663 | 3300017950 | Salt Marsh | MRGSISYHELMHVITNEDREIFYKIIKENIETVEKTKLPLL |
| Ga0181590_100687393 | 3300017967 | Salt Marsh | MRGSFSYHDLMYKITSEDLEILNKIIKDNIETVEKTRLPLL |
| Ga0181600_100069852 | 3300018036 | Salt Marsh | MRGSVSYHDLMYKISYEDLEIFNRIIKENIETTEKTKLPLL |
| Ga0181572_101113802 | 3300018049 | Salt Marsh | MRGSFSYHDLMYKITSEDLEILNKIIKENIETVEKTRLPLL |
| Ga0181558_101009083 | 3300018417 | Salt Marsh | YMRGSISYHELMHVITNEDREIFYKIIKENIETVEKTKLPLL |
| Ga0181563_100692492 | 3300018420 | Salt Marsh | MRGSFTYSDLMYKISHEDLEILNRIIKDNIETTEKTRMPLI |
| Ga0181593_108658992 | 3300018423 | Salt Marsh | MRGSMSYNDLMYKISHEDIEILNRIIKDNIDATEKSKLPLL |
| Ga0181595_101855921 | 3300020053 | Salt Marsh | GSFTYSDLMYKISHEDLEILNRIIKDNIETTEKTRMPLI |
| Ga0206124_102098052 | 3300020175 | Seawater | MRGSISYYELMHVITNEDREVFYKIIKENIETVEKTKMPLL |
| Ga0211504_10485812 | 3300020347 | Marine | MRGSFTYDDLMYKITPEDMEILNQIVKENIETTEKTRMPLI |
| Ga0211498_100897322 | 3300020380 | Marine | MRGAFSYHDLMYKISVDDLEILNKIIKDNIETTEKTRLPLV |
| Ga0211583_100739932 | 3300020397 | Marine | MRGSFTYDDLVFKITKEDREILNKIIKDNIEATKDSGMPIL |
| Ga0211576_101855402 | 3300020438 | Marine | MRGSISYHELMHVITNEDREVFYKIIKENIETVEKTKMPLL |
| Ga0211576_106051642 | 3300020438 | Marine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIEATEKTRMPLI |
| Ga0211518_105349682 | 3300020440 | Marine | MRGAFSYHDLMYKISNDDLEVINNIVKDNIETTEKTRMPLI |
| Ga0211676_101534422 | 3300020463 | Marine | MRGSFTYENLMYHTSTEDREILNRIIKDNIEATEKTKLPLI |
| Ga0211577_102849941 | 3300020469 | Marine | MRGSVSYKELMYSLSHDDIEIYNKIIKDNIETTEKTNLPLI |
| Ga0213859_104301531 | 3300021364 | Seawater | MRGSISYKELMYCISHEDIEIFNKIIKDNIETVEKTKLPLI |
| Ga0213869_100581402 | 3300021375 | Seawater | MRGSISYYELMHVITNEDREIFYKIIKENIETVEKTKLPLL |
| Ga0213868_104105291 | 3300021389 | Seawater | MRGSISYYELMHVITNEDREIFYKIIKENIETVEKTKLPLLXWLV |
| Ga0222717_100535322 | 3300021957 | Estuarine Water | MRGSMSYHDLMYKISTDDLEIFNKIIQDNLETVEKTKLPLL |
| Ga0222718_103445592 | 3300021958 | Estuarine Water | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIDATEKTRMPLI |
| Ga0222718_103498952 | 3300021958 | Estuarine Water | MRGSISYYELMHVITNEDREIFYKIIKENIETVEKTKMPLL |
| Ga0222716_100844262 | 3300021959 | Estuarine Water | MWYMRGSVSYNEIMYDIDVSDYEIFNRIIKENWETTNKTGLPLV |
| Ga0222715_100283882 | 3300021960 | Estuarine Water | MRGSVSYNEIMYDIDVSDYEIFNRIIKENWETTNKTGLPLV |
| Ga0222719_103278002 | 3300021964 | Estuarine Water | MRGSLTYDDLMHTITVEDREILQKIIKENIDLVEKTKLPLL |
| Ga0222645_1035703 | 3300022833 | Saline Water | MRGSFTYDDLMYKISHEDLEVLNQIIKENIETTEKTRMPLM |
| Ga0222649_10185462 | 3300022839 | Saline Water | MRGSFTYSDLMYKISHEDLEILNRIIKDNIETTEKTRM |
| (restricted) Ga0233432_100176684 | 3300023109 | Seawater | MRGSLTYKDLMYHISNDDMEIFQNIIKDNIDATEKTRMPLI |
| (restricted) Ga0233432_100291932 | 3300023109 | Seawater | MRGSVSYHELMYNISHEDIEIYNRIIKDNIETTEKTNLPLI |
| (restricted) Ga0233432_102627222 | 3300023109 | Seawater | MRGSITYHELMHVITNEDREVFYKIIKENIETVEKTKMPLL |
| Ga0255768_104317282 | 3300023180 | Salt Marsh | MSYNDLMYKISHEDIEILNRIIKDNIDATEKSKLPLL |
| Ga0228636_10378762 | 3300024191 | Seawater | MRGSLTYKDLMYHISNEDMEIFQNIIKDNIDATEKTKLPLI |
| Ga0228665_11309102 | 3300024235 | Seawater | SLTYKDLMYHISNEDMEIFQNIIKDNIDATEKTKLPLI |
| Ga0208791_10399462 | 3300025083 | Marine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIEATEKTKLPLI |
| Ga0208793_10312122 | 3300025108 | Marine | MRGSLTYKDLMYHISNDDMEIFNNIIKDNIDATEKTKMPLI |
| Ga0209557_11171762 | 3300025483 | Marine | MRGSINYIDLMYHISHDDLEIFNRIIKDNIETTEKTRLPLL |
| Ga0208660_10314662 | 3300025570 | Aqueous | MRGSFTYENLMYHTTVEDREILNKIIKDNIETTEKTKMPLL |
| Ga0209654_10056964 | 3300025608 | Marine | MRGAMSYDDLFFKISFEDREIMNAIVKDNIETTNKTKMPLI |
| Ga0208149_10401661 | 3300025610 | Aqueous | MRGSMTYHDLMHTISADDREIFGKIIKENIETVEKTKLPLL |
| Ga0209716_10504112 | 3300025626 | Pelagic Marine | MRGAFSYHDLMYKISNDDLEVMNNIVKDNIETTEKTRMPLI |
| Ga0209716_11700642 | 3300025626 | Pelagic Marine | MRGSMSYHDLMYKISTDDLEIFNKIIQDNLDTVEKTKLPLL |
| Ga0209653_11657042 | 3300025695 | Marine | MRGSISYQDLMYSISREDIEIFNNIIKDNIEATEKTRMPLI |
| Ga0209532_11539002 | 3300025696 | Pelagic Marine | MRGSMSYHDLMYKISSDDLEIFNKIIQDNLDTVEKTKLPLL |
| Ga0208304_100571151 | 3300027751 | Estuarine | MRGSMSYHDLMYKISTDDLEIFNKIIQDNLETVEKTKLP |
| Ga0209192_100129072 | 3300027752 | Marine | MRGSFGYHDLMYKISNDDIEVMNNIIKDNIEATEKTKMPLI |
| Ga0209192_100166963 | 3300027752 | Marine | MRGSISYNELMYDISRDDIEIYNKIIKDNIETTEKTNLPLL |
| Ga0209711_101544841 | 3300027788 | Marine | MRGSFTYDDLMYKITSEDLEILNQIVKDNIETTEKTRLPLM |
| Ga0209302_100430362 | 3300027810 | Marine | MRGSFTYHDLMYKISHEDLEILNKIIKDNIETTEKTRMPLI |
| Ga0209302_103722441 | 3300027810 | Marine | MRGSMAYHDLMYKISRDDIEVFDRIIKDNIETTEKTRMPLI |
| Ga0209090_100370072 | 3300027813 | Marine | MRGSFSYENLMYHTSIEDREILNKIIKDNIETTEKTRMPLI |
| Ga0209090_102481891 | 3300027813 | Marine | MRGSITYHELMHVITNEDREVFYKIIKENIETVEKTKM |
| Ga0209090_103134542 | 3300027813 | Marine | MRGSISYNELMYNISRDDIEIYNKIIKDNIETTEKTNLPLL |
| Ga0307488_100179762 | 3300031519 | Sackhole Brine | MRGSFTYNDLMYKISHDDLEVLNQIVKDNIETTEKTRMPLM |
| Ga0307488_100310774 | 3300031519 | Sackhole Brine | MRGSLSYTDLMYRISYEDLEIFNNIIKDNIETTEKTRMPLL |
| Ga0307488_100481592 | 3300031519 | Sackhole Brine | MRGSFNYHDLMYKISHEDLEILNNIVRDNIEATEKTRMPLI |
| Ga0315320_104456372 | 3300031851 | Seawater | MRGGISYTDLMYHISHDDLEIFNKIIADNIETVEKTKLPL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |