| Basic Information | |
|---|---|
| Family ID | F088703 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VTYRVAVADKVAEAGLKLLAQTPEIEVANCAGKPREELERALAGA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.67 % |
| % of genes near scaffold ends (potentially truncated) | 94.50 % |
| % of genes from short scaffolds (< 2000 bps) | 82.57 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.991 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.771 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.725 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.29% β-sheet: 13.70% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00266 | Aminotran_5 | 50.46 |
| PF00857 | Isochorismatase | 7.34 |
| PF00202 | Aminotran_3 | 3.67 |
| PF00583 | Acetyltransf_1 | 1.83 |
| PF02826 | 2-Hacid_dh_C | 1.83 |
| PF00696 | AA_kinase | 1.83 |
| PF07676 | PD40 | 0.92 |
| PF00389 | 2-Hacid_dh | 0.92 |
| PF02774 | Semialdhyde_dhC | 0.92 |
| PF01745 | IPT | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 7.34 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.34 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.92 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.99 % |
| Unclassified | root | N/A | 11.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10268469 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300002909|JGI25388J43891_1002509 | All Organisms → cellular organisms → Bacteria | 3812 | Open in IMG/M |
| 3300002911|JGI25390J43892_10032616 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300002912|JGI25386J43895_10066378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 995 | Open in IMG/M |
| 3300002916|JGI25389J43894_1016619 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300002916|JGI25389J43894_1070869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005166|Ga0066674_10325823 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005167|Ga0066672_10184985 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300005167|Ga0066672_10263105 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300005171|Ga0066677_10117036 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300005171|Ga0066677_10195231 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005176|Ga0066679_10951167 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005180|Ga0066685_10157132 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300005184|Ga0066671_10179743 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300005434|Ga0070709_11799055 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005444|Ga0070694_100007016 | All Organisms → cellular organisms → Bacteria | 6850 | Open in IMG/M |
| 3300005446|Ga0066686_10550627 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005451|Ga0066681_10238580 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005540|Ga0066697_10265337 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300005540|Ga0066697_10335059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 883 | Open in IMG/M |
| 3300005540|Ga0066697_10758478 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005549|Ga0070704_100390805 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005552|Ga0066701_10031453 | All Organisms → cellular organisms → Bacteria | 2765 | Open in IMG/M |
| 3300005552|Ga0066701_10070090 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300005553|Ga0066695_10060766 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300005555|Ga0066692_10572638 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005558|Ga0066698_10449171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 880 | Open in IMG/M |
| 3300006755|Ga0079222_10031610 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300006800|Ga0066660_10033609 | All Organisms → cellular organisms → Bacteria | 3183 | Open in IMG/M |
| 3300006800|Ga0066660_11563881 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006804|Ga0079221_10046012 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300006904|Ga0075424_102674413 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009012|Ga0066710_104017485 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009088|Ga0099830_10364083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1165 | Open in IMG/M |
| 3300010107|Ga0127494_1035572 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010122|Ga0127488_1101893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300010127|Ga0127489_1130618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 855 | Open in IMG/M |
| 3300010301|Ga0134070_10224889 | Not Available | 695 | Open in IMG/M |
| 3300010304|Ga0134088_10241567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 868 | Open in IMG/M |
| 3300010304|Ga0134088_10447974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 632 | Open in IMG/M |
| 3300010325|Ga0134064_10481243 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010326|Ga0134065_10086538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1021 | Open in IMG/M |
| 3300010329|Ga0134111_10131332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 981 | Open in IMG/M |
| 3300010329|Ga0134111_10573651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
| 3300010335|Ga0134063_10106503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1276 | Open in IMG/M |
| 3300010337|Ga0134062_10118311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1153 | Open in IMG/M |
| 3300010337|Ga0134062_10374897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 691 | Open in IMG/M |
| 3300010337|Ga0134062_10622352 | Not Available | 558 | Open in IMG/M |
| 3300010373|Ga0134128_10733274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1097 | Open in IMG/M |
| 3300012201|Ga0137365_10510892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 883 | Open in IMG/M |
| 3300012206|Ga0137380_10885511 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300012207|Ga0137381_10148744 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300012207|Ga0137381_11751238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300012211|Ga0137377_10015268 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium JGI 053 | 6630 | Open in IMG/M |
| 3300012228|Ga0137459_1047173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1224 | Open in IMG/M |
| 3300012360|Ga0137375_10373506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1256 | Open in IMG/M |
| 3300012362|Ga0137361_10415994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1235 | Open in IMG/M |
| 3300012362|Ga0137361_11508497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 594 | Open in IMG/M |
| 3300012371|Ga0134022_1145187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1648 | Open in IMG/M |
| 3300012392|Ga0134043_1186260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 717 | Open in IMG/M |
| 3300012931|Ga0153915_12973555 | Not Available | 552 | Open in IMG/M |
| 3300012976|Ga0134076_10004327 | All Organisms → cellular organisms → Bacteria | 4600 | Open in IMG/M |
| 3300014154|Ga0134075_10534733 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300014166|Ga0134079_10025871 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300015053|Ga0137405_1011106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1071 | Open in IMG/M |
| 3300015241|Ga0137418_10013066 | All Organisms → cellular organisms → Bacteria | 7672 | Open in IMG/M |
| 3300015241|Ga0137418_10066384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3293 | Open in IMG/M |
| 3300015241|Ga0137418_10747799 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300015372|Ga0132256_100288799 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300017654|Ga0134069_1303380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 566 | Open in IMG/M |
| 3300017657|Ga0134074_1319958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300017659|Ga0134083_10464164 | Not Available | 562 | Open in IMG/M |
| 3300017974|Ga0187777_10028186 | All Organisms → cellular organisms → Bacteria | 3597 | Open in IMG/M |
| 3300017974|Ga0187777_11224038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300018071|Ga0184618_10296304 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300018431|Ga0066655_10360247 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 956 | Open in IMG/M |
| 3300018433|Ga0066667_10339653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1188 | Open in IMG/M |
| 3300018433|Ga0066667_11269863 | Not Available | 643 | Open in IMG/M |
| 3300018433|Ga0066667_11305240 | Not Available | 634 | Open in IMG/M |
| 3300018482|Ga0066669_11380743 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300019279|Ga0184642_1166906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 712 | Open in IMG/M |
| 3300019789|Ga0137408_1292727 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300021051|Ga0206224_1019705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 796 | Open in IMG/M |
| 3300021080|Ga0210382_10295806 | Not Available | 712 | Open in IMG/M |
| 3300024330|Ga0137417_1244596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1229 | Open in IMG/M |
| 3300025324|Ga0209640_11101047 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
| 3300025992|Ga0208775_1014904 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026277|Ga0209350_1053967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1160 | Open in IMG/M |
| 3300026295|Ga0209234_1003181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 6240 | Open in IMG/M |
| 3300026296|Ga0209235_1281661 | Not Available | 508 | Open in IMG/M |
| 3300026297|Ga0209237_1026120 | All Organisms → cellular organisms → Bacteria | 3255 | Open in IMG/M |
| 3300026301|Ga0209238_1066859 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1268 | Open in IMG/M |
| 3300026314|Ga0209268_1046418 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300026326|Ga0209801_1013289 | All Organisms → cellular organisms → Bacteria | 4191 | Open in IMG/M |
| 3300026334|Ga0209377_1250592 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300026343|Ga0209159_1198070 | Not Available | 652 | Open in IMG/M |
| 3300026524|Ga0209690_1069222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1513 | Open in IMG/M |
| 3300026532|Ga0209160_1215689 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300026536|Ga0209058_1151483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1087 | Open in IMG/M |
| 3300026537|Ga0209157_1027218 | All Organisms → cellular organisms → Bacteria | 3382 | Open in IMG/M |
| 3300026550|Ga0209474_10619921 | Not Available | 555 | Open in IMG/M |
| 3300026700|Ga0208474_100742 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300027643|Ga0209076_1011826 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300028138|Ga0247684_1010440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1451 | Open in IMG/M |
| 3300032205|Ga0307472_100116835 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300032770|Ga0335085_10066101 | All Organisms → cellular organisms → Bacteria | 4807 | Open in IMG/M |
| 3300032828|Ga0335080_12365416 | Not Available | 507 | Open in IMG/M |
| 3300032955|Ga0335076_11289189 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.51% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.92% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026700 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN350 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J37095_102684692 | 3300002562 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVANCAGKPREELERALAGAHALIVRS |
| JGI25388J43891_10025096 | 3300002909 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREELERALAGADALIVRS |
| JGI25390J43892_100326161 | 3300002911 | Grasslands Soil | VTYRVVLADRVAESGVRLLAETPEIEVVSLAGKPRDELERALAG |
| JGI25386J43895_100663781 | 3300002912 | Grasslands Soil | VTHRVVVADRVAEGGLQLLAATPDLEVASFAGKPREELERAL |
| JGI25389J43894_10166192 | 3300002916 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVTSFAGKPREELERALAGAD |
| JGI25389J43894_10708691 | 3300002916 | Grasslands Soil | VSVRVVVADRLTEAGLKLLAATPDVEVVNCAGKPRDELERALAG |
| Ga0066674_103258231 | 3300005166 | Soil | VTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERALAGAHAL |
| Ga0066672_101849851 | 3300005167 | Soil | VVVADRVTDAGLKLLAATPDIEVVNCAGKPRDELERALGGAHALI |
| Ga0066672_102631051 | 3300005167 | Soil | MTHRVVVADKLGEAGFALLAKEADIEVVNCAGKPREELERA |
| Ga0066677_101170361 | 3300005171 | Soil | VVVADRLTEAGLKLLAATPEIEVVNCAGKPRDELERALGGAHALI |
| Ga0066677_101952312 | 3300005171 | Soil | VSVRVVVADRLTEAGLKLLAATPDVEVVNCAGKPRDELERAL |
| Ga0066679_109511672 | 3300005176 | Soil | VSYRVVLADRVAESGVRLLAETPEIEVVNLAGKPREELDRALAGA |
| Ga0066685_101571321 | 3300005180 | Soil | VNYRVAVADKVAEAGLTLLAETPEIEVANCAGKPREELERALAGAHA |
| Ga0066671_101797432 | 3300005184 | Soil | VSVRVVVADRLTEAGLKLLAATPEIEVVNCAGKPRDELERALGGAHALI |
| Ga0070709_117990552 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VTYRVAVADKVAEAGLKLLAETPGIEVANCAGKPREELER |
| Ga0070694_1000070161 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VTYRVAVADKVAEAGLKLLGETPGIEVANCAGKPREELERALGGAH |
| Ga0066686_105506271 | 3300005446 | Soil | VTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERALAGAHALIVRSE |
| Ga0066681_102385802 | 3300005451 | Soil | VTYRVAVADRVAETGLKLLGATPEIEIANCAGKPREELERALAGAHALIVR |
| Ga0066697_102653372 | 3300005540 | Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALIVRSETR |
| Ga0066697_103350592 | 3300005540 | Soil | VTHRVVVADRVAEGGLQLLAATPDVEVASFAGKPREELE |
| Ga0066697_107584781 | 3300005540 | Soil | MSVRVVVADRLTEAGLKLLAATPEIEVVNCAGKPRDELERALG |
| Ga0070704_1003908051 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VTYRVAVADKVAEAGLKLLAETPGIEVANCAGKPREELERAL |
| Ga0066701_100314535 | 3300005552 | Soil | VTHRVVIADRVADAGLRLLAATPEIEVTNCAGKPRE |
| Ga0066701_100700901 | 3300005552 | Soil | VTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERALAGAH |
| Ga0066695_100607664 | 3300005553 | Soil | VTHHVVVADRVAEGGLALLAATPDVEVASFAGKPREELERALA |
| Ga0066692_105726382 | 3300005555 | Soil | MTYRVVVADKLAASGLSLLAESPEFEVVNVAGKPREELER |
| Ga0066698_104491712 | 3300005558 | Soil | VTWRVVIADKVAKSGLDLLAATPEVELVSVAGKPREELERAL |
| Ga0079222_100316101 | 3300006755 | Agricultural Soil | VSSRVVVADRVQDAGLKVLAATPGIEVVTCAGKPREELERALGGAHALI |
| Ga0066660_100336091 | 3300006800 | Soil | VSVRVVVADRVTDAGLKLLAATPDIEVVNCAGKPRDELERALGGAHALI |
| Ga0066660_115638811 | 3300006800 | Soil | MSVRVVVADRLTEAGLKLLAATPEIEVVNCAGKPRDELE |
| Ga0079221_100460121 | 3300006804 | Agricultural Soil | VTSPHSHRVVVADKVAETGLKLLAATAGIEVVNCAGKPR |
| Ga0075424_1026744132 | 3300006904 | Populus Rhizosphere | VSVRVVVADRLTEAGLKLLAATPEVEVVNCAGKPRD |
| Ga0066710_1021741532 | 3300009012 | Grasslands Soil | MTTPPPSWRVVVADKLAESGLRLLETTPGIEVVNMAGKPREELD |
| Ga0066710_1040174851 | 3300009012 | Grasslands Soil | VTHRVVVADRVAETGLKLLAATPDIEVVNCAGKPR |
| Ga0099830_103640832 | 3300009088 | Vadose Zone Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAG |
| Ga0127494_10355722 | 3300010107 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERAL |
| Ga0127488_11018932 | 3300010122 | Grasslands Soil | VTYRVAVADKVAEAGLTLLAETPEIEVANCAGKPREELER |
| Ga0127489_11306181 | 3300010127 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALIVRS |
| Ga0134070_102248891 | 3300010301 | Grasslands Soil | VTHHVVVADRVAEGGLALLAATPDVEVASFAGKPREELERALAGADAL |
| Ga0134088_102415671 | 3300010304 | Grasslands Soil | MTWRVVVADKLADSGLRLLEATPGIEVLNVAGKPREELEQALAGAHALI |
| Ga0134088_104479741 | 3300010304 | Grasslands Soil | VTWRVVIADKVAKSGLDLLAATPEVELVSVAGKPREELERALA |
| Ga0134064_104812432 | 3300010325 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREELERALAGADALIVRSET |
| Ga0134065_100865381 | 3300010326 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALIVRSET |
| Ga0134111_101313321 | 3300010329 | Grasslands Soil | MIHRVVIADRVAEAGLKLLAATPELEVANVAGRPREELERALAGAHALVV |
| Ga0134111_105736511 | 3300010329 | Grasslands Soil | VNYRVAVADKVAEAGLTLLAETPEIEVANCAGKPREELERALAGAHALIVR |
| Ga0134063_101065032 | 3300010335 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREELERALAARTP* |
| Ga0134062_101183111 | 3300010337 | Grasslands Soil | VSVRVVVADRLTEAGLKLLAATPEIEVVNCAGKPRDELER |
| Ga0134062_103748971 | 3300010337 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERALAGAHALIV |
| Ga0134062_106223522 | 3300010337 | Grasslands Soil | MTHRVVVADRLAEAGLQLLAATPELEVANVAGRPREE |
| Ga0134128_107332741 | 3300010373 | Terrestrial Soil | VTYRVAVADKVAEAGLKLLAETPGIEVANCAGKPREELERALGGA |
| Ga0137365_105108921 | 3300012201 | Vadose Zone Soil | MTHRVVVADRLAEAGLQLLAATPELEVVNVAGRPREELE |
| Ga0137380_108855111 | 3300012206 | Vadose Zone Soil | VNYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELE |
| Ga0137381_101487443 | 3300012207 | Vadose Zone Soil | VTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERALAGAHALIVRS |
| Ga0137381_117512382 | 3300012207 | Vadose Zone Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGA |
| Ga0137377_100152689 | 3300012211 | Vadose Zone Soil | VTHRVVIADRVAETGLQLLAATPEIEVANCAGKPR |
| Ga0137459_10471732 | 3300012228 | Soil | MTLRVVVADRVAKAGLAELEGSPEIEVANLAGQPHEALLQALAGAHALIVR |
| Ga0137375_103735061 | 3300012360 | Vadose Zone Soil | VTWRVVIADKVAKSGLDLLAATPEVELVSVAGKPREDLERALAGAHALIVRSET |
| Ga0137361_104159941 | 3300012362 | Vadose Zone Soil | LTYRVAIADKVAEAGLKLLAATPEIEVVNCAGKPREELERALA |
| Ga0137361_115084971 | 3300012362 | Vadose Zone Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVANCAGKPREELERALAGAHALIVRSETR |
| Ga0134022_11451871 | 3300012371 | Grasslands Soil | VTYRIAVADKVAEAGLKLLAGTPEIEVANCAGKPREELERALAGAHALIVRSETR |
| Ga0134043_11862602 | 3300012392 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVANCAGKPREELERALAGA |
| Ga0153915_129735551 | 3300012931 | Freshwater Wetlands | VTLRVVVADKMAPVGLELLARTPGLEVANCVGKPREELERALEGGH |
| Ga0134076_100043272 | 3300012976 | Grasslands Soil | VTYRVAVADKVTEAGLKLLAATPEIEVANCAGKPRE* |
| Ga0134075_105347332 | 3300014154 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAETPEIEVFNCAGKPREELERALAGAHAL |
| Ga0134079_100258711 | 3300014166 | Grasslands Soil | MSVRVVVADRLTEAGLKLLAATPEIEVVNCAGKPR |
| Ga0137405_10111061 | 3300015053 | Vadose Zone Soil | MTYRVAVADKVAEAGLKLLAATPEIEVVNCAGKPREELERALRALAGAHALIV |
| Ga0137418_1001306610 | 3300015241 | Vadose Zone Soil | VTYRVAVADKVAEAGLKLLAETPGIEVANCAGKPREELERALGGAHALI |
| Ga0137418_100663845 | 3300015241 | Vadose Zone Soil | VSYRVAVADKVAEAGLKLLAETPEIEVANCAGKPREELERALGGAHALI |
| Ga0137418_107477991 | 3300015241 | Vadose Zone Soil | VTYRVVLADRVAESGVRLLAETPEIEVVNLAGKPREELERALAGAHGLVV |
| Ga0132256_1002887993 | 3300015372 | Arabidopsis Rhizosphere | VSERVVVADRVADAGLKLLAATRELEVVNCAGKPREEL |
| Ga0134069_13033801 | 3300017654 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALI |
| Ga0134074_13199581 | 3300017657 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALIV |
| Ga0134083_104641641 | 3300017659 | Grasslands Soil | VTQRVVVADRVAEAGLKLLAATSELEVANCAGRPRDELERALAGAEALIVRS |
| Ga0187777_100281865 | 3300017974 | Tropical Peatland | VTLRVVVADRMAAGGLELLARTPGIEVVNCAGKPPEELQRALE |
| Ga0187777_112240382 | 3300017974 | Tropical Peatland | VTYRVVVADRVADAGLKQLAASPEIEVAAVAGKPPQGV |
| Ga0184618_102963042 | 3300018071 | Groundwater Sediment | VTYRVAVADKVAEAGLTLLAETPGIEVANCAGQPREELERALGGA |
| Ga0066655_103602471 | 3300018431 | Grasslands Soil | VSVRVVVADRLTEAGLKLLAATPDVEVVNCAGKPRDE |
| Ga0066667_103396531 | 3300018433 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREE |
| Ga0066667_112698632 | 3300018433 | Grasslands Soil | VTYRVVLADRVAESGVRLLAETPEIEVVSLAGKPRDELERALAGAHALVVR |
| Ga0066667_113052402 | 3300018433 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREELERA |
| Ga0066669_113807432 | 3300018482 | Grasslands Soil | MIHRVVIADRVAEAGLKLLAATPEIEVANVAGRPR |
| Ga0184642_11669061 | 3300019279 | Groundwater Sediment | VSYRVAVADKVAEAGLKLMAATPEIEVVNCAGKPREELE |
| Ga0137408_12927271 | 3300019789 | Vadose Zone Soil | MTYRVAVADKVAEAGLKLLAATPEIEVVNCAGKPREELERALAGAHA |
| Ga0206224_10197051 | 3300021051 | Deep Subsurface Sediment | VNLRVVVADRLAPGGLELLGRTPGVEVVNVAGQPREAL |
| Ga0210382_102958062 | 3300021080 | Groundwater Sediment | LSWRVVVADRVADSGLKLLAGTSEIEVVTVAGKPKDELDRALAGAHALI |
| Ga0137417_12445961 | 3300024330 | Vadose Zone Soil | VTYRVAVADKVAEAGLKLLAATPEIEVTNCAGKPREELERALAGAHALIVRSERPG |
| Ga0209640_111010471 | 3300025324 | Soil | LTTQRVVVADKMAAGGLELLARTPGIEVVNCAGKPREELERALERAHALI |
| Ga0208775_10149042 | 3300025992 | Rice Paddy Soil | VSHRVVVADKVAEAGLKLLAATPEIEVVVCAGKPREELERRFGRR |
| Ga0209350_10539672 | 3300026277 | Grasslands Soil | VTHHVVVADRVAEGGLALLAATPDVEVASFAGKPR |
| Ga0209234_10031811 | 3300026295 | Grasslands Soil | VTYRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALIVRSE |
| Ga0209235_12816611 | 3300026296 | Grasslands Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREELERAL |
| Ga0209237_10261205 | 3300026297 | Grasslands Soil | VTYRVVLADRVAESGVRLLAETPEIEVVNLAGKPREELERALAGA |
| Ga0209238_10668593 | 3300026301 | Grasslands Soil | VSYRVVLADRVAESGVRLLAETPEIEVVNLAGKPREELD |
| Ga0209268_10464181 | 3300026314 | Soil | MTYRVAVADKVAEAGLKLLAETPEIEVANCAGKPR |
| Ga0209801_10132896 | 3300026326 | Soil | VTYRVVLADRVAESGVRLLAETPEIEVVSLAGKPRDEL |
| Ga0209377_12505921 | 3300026334 | Soil | VTYRVVLADRVAESGVRLLAETPEIEVVNLAGKPREELERAL |
| Ga0209159_11980702 | 3300026343 | Soil | MTHRVVVADRLAEAGLQLLAATPELEVANVAGRPREELERALAGAHALIV |
| Ga0209690_10692223 | 3300026524 | Soil | MSVRVVVADRLTEAGLKLLAATPEIEVVNCAGKPRDELERALGGAQALIV |
| Ga0209160_12156891 | 3300026532 | Soil | VTHRVVIADRVADAGLRLLAATPEIEVTNCAGKPREELERALAGAAALGVRS |
| Ga0209058_11514832 | 3300026536 | Soil | VNYRVAVADKVAEAGLTLLAETPEIEVANCAGKPREELERALAGAHALI |
| Ga0209157_10272181 | 3300026537 | Soil | VTHHVVVADRVAEGGLALLAATPDVEVASFAGKPREELERAL |
| Ga0209474_106199211 | 3300026550 | Soil | VTLRVVVADRVAEGGLQLLAATPDIEVTSFAGTPR |
| Ga0208474_1007421 | 3300026700 | Soil | VTSPHSHRVVVADKVAETGLKLLAATAGIEVVNCAGKPRDELERALASA |
| Ga0209076_10118261 | 3300027643 | Vadose Zone Soil | VTLRVVVADRVAEGGLQLLAATPDIEVASFAGKPREEL |
| Ga0247684_10104401 | 3300028138 | Soil | VTLRVVVADRLAAGGLDLLAQTPGIEVVNCAGKGPEELE |
| Ga0307472_1001168353 | 3300032205 | Hardwood Forest Soil | VTHRVAVADKVAEAGLKLLAQTPEIEVTNCAGKPREELERALAGAHALI |
| Ga0335085_100661011 | 3300032770 | Soil | MTARVVVADRLAEGGLKMLAESPEVEVVNVAGKPREELL |
| Ga0335080_123654162 | 3300032828 | Soil | VTFRVVVADRVAQAGLDEFAATPAIEVANVAGRPREELQRAL |
| Ga0335076_112891892 | 3300032955 | Soil | VTFRVVVADRVAQAGLDEFAATPAIEVANVAGRPREELQRALSGAHALIV |
| ⦗Top⦘ |