| Basic Information | |
|---|---|
| Family ID | F088649 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSERQTAPVLELKHTAMSEEEALRFLDGHRITRGGRTMDPKAQIVG |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.30 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 93.58 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.817 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.761 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.523 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.97% β-sheet: 8.11% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF05544 | Pro_racemase | 20.18 |
| PF02633 | Creatininase | 10.09 |
| PF00496 | SBP_bac_5 | 5.50 |
| PF01042 | Ribonuc_L-PSP | 4.59 |
| PF00296 | Bac_luciferase | 4.59 |
| PF00106 | adh_short | 3.67 |
| PF01546 | Peptidase_M20 | 2.75 |
| PF04909 | Amidohydro_2 | 2.75 |
| PF08402 | TOBE_2 | 2.75 |
| PF01425 | Amidase | 1.83 |
| PF02627 | CMD | 1.83 |
| PF09296 | NUDIX-like | 1.83 |
| PF05685 | Uma2 | 0.92 |
| PF03928 | HbpS-like | 0.92 |
| PF13669 | Glyoxalase_4 | 0.92 |
| PF03171 | 2OG-FeII_Oxy | 0.92 |
| PF07470 | Glyco_hydro_88 | 0.92 |
| PF02738 | MoCoBD_1 | 0.92 |
| PF09297 | zf-NADH-PPase | 0.92 |
| PF00999 | Na_H_Exchanger | 0.92 |
| PF13181 | TPR_8 | 0.92 |
| PF08659 | KR | 0.92 |
| PF00528 | BPD_transp_1 | 0.92 |
| PF01850 | PIN | 0.92 |
| PF05694 | SBP56 | 0.92 |
| PF00005 | ABC_tran | 0.92 |
| PF01315 | Ald_Xan_dh_C | 0.92 |
| PF00578 | AhpC-TSA | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF07859 | Abhydrolase_3 | 0.92 |
| PF06055 | ExoD | 0.92 |
| PF04255 | DUF433 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 20.18 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 10.09 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 4.59 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.59 |
| COG2816 | NADH pyrophosphatase NudC, Nudix superfamily | Nucleotide transport and metabolism [F] | 2.75 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.83 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.83 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.83 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.92 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.92 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.92 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.92 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.92 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.92 |
| COG3932 | Exopolysaccharide synthesis protein ExoD | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.92 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.92 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.73 % |
| Unclassified | root | N/A | 19.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725003|GPWSG_F5G3JLY01A9U0T | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0571863 | Not Available | 543 | Open in IMG/M |
| 3300000559|F14TC_100670536 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300004024|Ga0055436_10297078 | Not Available | 522 | Open in IMG/M |
| 3300004052|Ga0055490_10239247 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004156|Ga0062589_101314573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 699 | Open in IMG/M |
| 3300004281|Ga0066397_10026642 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300004463|Ga0063356_105533103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300005171|Ga0066677_10782265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 529 | Open in IMG/M |
| 3300005174|Ga0066680_10750265 | Not Available | 593 | Open in IMG/M |
| 3300005332|Ga0066388_102169986 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1001 | Open in IMG/M |
| 3300005332|Ga0066388_102815832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300005332|Ga0066388_103635335 | Not Available | 787 | Open in IMG/M |
| 3300005332|Ga0066388_105398466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 648 | Open in IMG/M |
| 3300005334|Ga0068869_101891089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 535 | Open in IMG/M |
| 3300005445|Ga0070708_100970387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300005555|Ga0066692_10130989 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300005556|Ga0066707_10093625 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300005558|Ga0066698_10443925 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300005559|Ga0066700_10381178 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 995 | Open in IMG/M |
| 3300005569|Ga0066705_10610426 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005764|Ga0066903_101632421 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300005764|Ga0066903_101777627 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300005764|Ga0066903_104619575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300005764|Ga0066903_105059814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300006791|Ga0066653_10452535 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006844|Ga0075428_100769992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1024 | Open in IMG/M |
| 3300006852|Ga0075433_10265801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1520 | Open in IMG/M |
| 3300006854|Ga0075425_101522001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300006903|Ga0075426_10543905 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300007255|Ga0099791_10053923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1804 | Open in IMG/M |
| 3300007265|Ga0099794_10628481 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300007265|Ga0099794_10800684 | Not Available | 504 | Open in IMG/M |
| 3300009100|Ga0075418_12641157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 548 | Open in IMG/M |
| 3300009147|Ga0114129_12714509 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009162|Ga0075423_11264988 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300009176|Ga0105242_10733929 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300009792|Ga0126374_10028134 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300009792|Ga0126374_10812740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WD16 | 716 | Open in IMG/M |
| 3300009837|Ga0105058_1189536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300010046|Ga0126384_12151053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300010047|Ga0126382_11056856 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010047|Ga0126382_11797025 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010301|Ga0134070_10298886 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010335|Ga0134063_10260252 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010359|Ga0126376_11389908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WD16 | 726 | Open in IMG/M |
| 3300010360|Ga0126372_12303722 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010362|Ga0126377_11563831 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300010362|Ga0126377_11949735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
| 3300010362|Ga0126377_13234309 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010362|Ga0126377_13385738 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010376|Ga0126381_102443789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
| 3300010397|Ga0134124_10332739 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300010397|Ga0134124_11516810 | Not Available | 699 | Open in IMG/M |
| 3300010398|Ga0126383_10100190 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300010403|Ga0134123_13459602 | Not Available | 511 | Open in IMG/M |
| 3300012204|Ga0137374_10327952 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300012207|Ga0137381_11364803 | Not Available | 601 | Open in IMG/M |
| 3300012208|Ga0137376_10685723 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012349|Ga0137387_10906557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012351|Ga0137386_10619941 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012354|Ga0137366_10090075 | Not Available | 2329 | Open in IMG/M |
| 3300012363|Ga0137390_10469322 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300012582|Ga0137358_10149518 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300012902|Ga0157291_10419748 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012925|Ga0137419_10101209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1995 | Open in IMG/M |
| 3300012927|Ga0137416_10927617 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012971|Ga0126369_11771484 | Not Available | 706 | Open in IMG/M |
| 3300013297|Ga0157378_12656858 | Not Available | 553 | Open in IMG/M |
| 3300015052|Ga0137411_1117625 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300015358|Ga0134089_10375256 | Not Available | 603 | Open in IMG/M |
| 3300015358|Ga0134089_10524890 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300015373|Ga0132257_100870474 | Not Available | 1128 | Open in IMG/M |
| 3300015374|Ga0132255_102025331 | Not Available | 876 | Open in IMG/M |
| 3300016294|Ga0182041_10583798 | Not Available | 980 | Open in IMG/M |
| 3300016404|Ga0182037_10526850 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300016422|Ga0182039_10675329 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300018000|Ga0184604_10042198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300018052|Ga0184638_1130298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 916 | Open in IMG/M |
| 3300018054|Ga0184621_10275800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 596 | Open in IMG/M |
| 3300018064|Ga0187773_10818607 | Not Available | 594 | Open in IMG/M |
| 3300018078|Ga0184612_10310777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 806 | Open in IMG/M |
| 3300018082|Ga0184639_10373007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300019789|Ga0137408_1176451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2604 | Open in IMG/M |
| 3300025905|Ga0207685_10220882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 901 | Open in IMG/M |
| 3300025910|Ga0207684_10725920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300025942|Ga0207689_11577438 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025961|Ga0207712_11235933 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026089|Ga0207648_11545972 | Not Available | 624 | Open in IMG/M |
| 3300026089|Ga0207648_11869457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
| 3300026298|Ga0209236_1031101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2848 | Open in IMG/M |
| 3300026328|Ga0209802_1129047 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300027646|Ga0209466_1090157 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300028589|Ga0247818_10561929 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300028889|Ga0247827_10839213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37 | 612 | Open in IMG/M |
| 3300031170|Ga0307498_10246476 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031561|Ga0318528_10325510 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031720|Ga0307469_10231736 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300031720|Ga0307469_12532063 | Not Available | 502 | Open in IMG/M |
| 3300031731|Ga0307405_11805475 | Not Available | 544 | Open in IMG/M |
| 3300031740|Ga0307468_100785735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 809 | Open in IMG/M |
| 3300031858|Ga0310892_10225182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1143 | Open in IMG/M |
| 3300031897|Ga0318520_10736143 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300032012|Ga0310902_10133862 | Not Available | 1379 | Open in IMG/M |
| 3300032089|Ga0318525_10030646 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300032180|Ga0307471_100857975 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1075 | Open in IMG/M |
| 3300032205|Ga0307472_101718018 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300032211|Ga0310896_10559419 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.92% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725003 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWSG_02624230 | 2067725003 | Soil | MSDKQTAPTLELAHTAMSEEDALRFLDGHRISRGARTMDPKAQIVGEFVKS |
| ICChiseqgaiiDRAFT_05718632 | 3300000033 | Soil | MSDKQTAPTMELAHTAMSEEDALRFLDGHRISRGARTMDPKAQIVG |
| F14TC_1006705361 | 3300000559 | Soil | MTERAATTLELVHTMMDEAEAVRFLEGQRISLGGRTMDPKAQI |
| Ga0055436_102970782 | 3300004024 | Natural And Restored Wetlands | MGETAPVLELAHISMSEDEALRFLDGHRISRGGRTMNPKAQIVGE |
| Ga0055490_102392472 | 3300004052 | Natural And Restored Wetlands | MSHPTLELSHTMLSEAEALRLLDGHRIRLGSRTMDPKAQIVG |
| Ga0062589_1013145732 | 3300004156 | Soil | MTDRTAPPQLELAHTLMTEEEALRFLDGHRIRHGSRVMDP |
| Ga0066397_100266421 | 3300004281 | Tropical Forest Soil | MSDARAHPKLEISHTAMSEEDALRFLDGHRIRLGHRTMDPKAQIVGEFVK |
| Ga0063356_1055331032 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSEQGTHPKLELAHTAMSEADALRLLEGHRIRRGSRTMDPK |
| Ga0066677_107822651 | 3300005171 | Soil | MSTHPALDMSHTAMSEEDALRFLEGHRIRMGSRTMDPKAQIVGEFV |
| Ga0066680_107502652 | 3300005174 | Soil | MSERQTALALELKHTTMSEEEALRFLDGHRISRGGRTMDPK |
| Ga0066388_1021699862 | 3300005332 | Tropical Forest Soil | MSVPKTTATLELAHTAMSGAEALRFLEGQRIRIGGRTMDPK |
| Ga0066388_1028158322 | 3300005332 | Tropical Forest Soil | MSASKTTTALELAHTAMSEAEALRFLEGQRIRIGGRTMDPKAQIV |
| Ga0066388_1036353353 | 3300005332 | Tropical Forest Soil | MTDPSALPKLELSHTAMSEDDALRFLEGHRIRRGSRTMDPKAQIVGEF |
| Ga0066388_1053984661 | 3300005332 | Tropical Forest Soil | MSTHPPLELSHTALSEGEALRFLEGHRIRLGNRTMDPKAQI |
| Ga0068869_1018910891 | 3300005334 | Miscanthus Rhizosphere | MSTHPTLELSHTAMSEEDALRLLDGHRIKMGDRTMDPKAQIVG |
| Ga0070708_1009703871 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEKQTAPALALQHTMLSEDDAQRFLDGHRISLGGRTMDPKAQIV |
| Ga0066692_101309893 | 3300005555 | Soil | MSELRTQPKLELSHTAMSEEDALRFLEGHRNRLGSRTMDPKAQIVG |
| Ga0066707_100936251 | 3300005556 | Soil | MSDGQAAAVTLELAHTMLSEEEALRFLDGHRITRGG |
| Ga0066698_104439251 | 3300005558 | Soil | MSAHPTLDMTHTAMSEEDALRFLDGHRIRMGSRTM |
| Ga0066700_103811783 | 3300005559 | Soil | MSERQTAPALELKHTAMSEEEALRFLDGHRISRGGRTMD |
| Ga0066705_106104263 | 3300005569 | Soil | MSAHPALDMTHTAMSEEDALRFLEGHRIRMGSRTMDPKAQIVGE |
| Ga0066903_1016324212 | 3300005764 | Tropical Forest Soil | MSEQRTAPVLELQHTAMSEAEALHFLEGHRISRGARTMDPKAQIV |
| Ga0066903_1017776271 | 3300005764 | Tropical Forest Soil | MSERATHPVPQLSDTAMSEAEALRFLDDHRVRLGSRTMDPKAQIVGEF |
| Ga0066903_1046195751 | 3300005764 | Tropical Forest Soil | MSTSKTTTTLELAHTAMSEAEALRFLEGQRIRIGGRTMDPKAQIV |
| Ga0066903_1050598142 | 3300005764 | Tropical Forest Soil | MAERQTAPALTLQNTMMGEEEARRFLKGHRISLGGRTMDPKAQIVGEFVKSIRV |
| Ga0066653_104525352 | 3300006791 | Soil | MSERQTALALELKHTAMSEEDALRFLDGHRMSRGGRTMDPEAQSVGEFV |
| Ga0075428_1007699921 | 3300006844 | Populus Rhizosphere | MTHQPTLPKLELSHTLMPENDALRFLAGHRITMGSRTMDPKAQL |
| Ga0075433_102658011 | 3300006852 | Populus Rhizosphere | MSTHPPLELSHTTLSEEDALRFLEGHRIRLGSRTMDPKAQIVG |
| Ga0075425_1015220011 | 3300006854 | Populus Rhizosphere | MAERQTAPALTLQHTTMSEEEARRFLDGHRISLAGRTMDPKAQIVGE |
| Ga0075426_105439052 | 3300006903 | Populus Rhizosphere | MSTHPALDLSHTAMSEEDALRLLDGHRIKMGDRTM |
| Ga0099791_100539234 | 3300007255 | Vadose Zone Soil | MSELRTKPTFELAHTAMSEAEALRFLEGHRISLGGRTMDPKAQIVGEFVK |
| Ga0099794_106284811 | 3300007265 | Vadose Zone Soil | MSDRQAAAATLELAHTMLSEEEALRFLDGHRITRGGRIM |
| Ga0099794_108006841 | 3300007265 | Vadose Zone Soil | MSEATTRPTLTLEHTAMGEAEALQFLAGHRITRGGRTMDPKAQIVG |
| Ga0075418_126411571 | 3300009100 | Populus Rhizosphere | MSEATTKRPATPTLELSHTLLSEADALRLLDGHRITRGERTMDPKAQIVGEF |
| Ga0114129_127145091 | 3300009147 | Populus Rhizosphere | MNLTLEHAALSEADALKLLDGQRITLRGRTMDPKAQIV |
| Ga0075423_112649883 | 3300009162 | Populus Rhizosphere | MSDLRTHPKLELSHTAMSEQDALRFLEGHRIRLGDR |
| Ga0105242_107339291 | 3300009176 | Miscanthus Rhizosphere | MSERATHPVLELAHTALSEADALRLLDGHRIRRGSRTMDPKAQ |
| Ga0126374_100281343 | 3300009792 | Tropical Forest Soil | MSTHPTLEMSHTAMSEDDALRFLEGHRIRMGSRTMDPK |
| Ga0126374_108127401 | 3300009792 | Tropical Forest Soil | MSEQRTTPAFDLSHTAMSEADALGFLEGQRISRGGRTMEPKAQIVGEFVKSI |
| Ga0105058_11895362 | 3300009837 | Groundwater Sand | MSEPRTQPALELSHTTMSEEDALRFLDGHRIRLGSRT |
| Ga0126384_121510532 | 3300010046 | Tropical Forest Soil | MTTLELAHTLMTEPDALRFVDGQRIRRGGRVMDPK |
| Ga0126382_110568561 | 3300010047 | Tropical Forest Soil | MTDATTGPTLTLEHTALSEAEALKLLDGHRVTVAGRTMDPKAQIIGEF |
| Ga0126382_117970251 | 3300010047 | Tropical Forest Soil | MSDAPTHPKLELSHTAMSEEDALRFLDGHRIRLGNRTLDPKAQIVGE |
| Ga0126382_122226511 | 3300010047 | Tropical Forest Soil | MSQIQHSSKLELAHTLMSEDDALSFLAGQRISRGGRTMDPK |
| Ga0134070_102988861 | 3300010301 | Grasslands Soil | MSDRQAAAVTLELAHTMLSEEEALRFLDGHRITRGGRIMD |
| Ga0134063_102602522 | 3300010335 | Grasslands Soil | MSDRQAAAVTLELAHTMLSEEEALRFLDGHRITRGGRIMDPKAQIVGEFVKS |
| Ga0126376_113899082 | 3300010359 | Tropical Forest Soil | MSEQRTTPAFDLSHTAMSEEDALRFLDGHRIRMGSRTMDPKAQIVGEFVK |
| Ga0126372_123037222 | 3300010360 | Tropical Forest Soil | MSTHPTLDLSHTALSEEDALRLLDGHRISMGTRTMDPKAQIVGEFV |
| Ga0126377_115638312 | 3300010362 | Tropical Forest Soil | MSDLPKLELAHTLMSEDEALRLLAGHRISRGGRTMDPKA |
| Ga0126377_119497352 | 3300010362 | Tropical Forest Soil | MSVPKTTTTLELAHTAMSEAEALRFLEGQRIRIGGRTMDPKAQIVGE |
| Ga0126377_132343091 | 3300010362 | Tropical Forest Soil | LWIEEESMSTHPTLEMSHTAMSEEDALRFLDGHRIRM |
| Ga0126377_133857381 | 3300010362 | Tropical Forest Soil | MSTHPTLDLSHTAMSEEDALRLLDGHRISMGTRTMDPKAQ |
| Ga0126381_1024437891 | 3300010376 | Tropical Forest Soil | MSVPKTTTTLELAHTAMSEAEALRFLEGQRIRIGGRIMDPKAQIV |
| Ga0134124_103327391 | 3300010397 | Terrestrial Soil | MSTHPTLDLSHTAMSEADALRFLDGHRISMGGRTMDPKAQIVGEF |
| Ga0134124_115168101 | 3300010397 | Terrestrial Soil | MTDKQTAPTLELAHTLMSETDALAFLHGYRISRGARTMDPKAQIVGEFVKS |
| Ga0126383_101001903 | 3300010398 | Tropical Forest Soil | LWIEEESMSTHPPLEMAHTAMSEEDALRFLEGHRIR |
| Ga0134123_134596022 | 3300010403 | Terrestrial Soil | MSTHPPLELSHTALSEDEALRFLEGHRIRLGGRTM |
| Ga0137374_103279525 | 3300012204 | Vadose Zone Soil | MSERQTALAMELKHTAMSEEEALRFLDGHRISRGGR |
| Ga0137381_113648032 | 3300012207 | Vadose Zone Soil | MSERQTAPVLELKHTAMSEEEALRFLDGHRITRGGRTMDPKAQIVG |
| Ga0137376_106857231 | 3300012208 | Vadose Zone Soil | MSTHPTLDLSHTAMSEEDALRLLDGHRIKMGDRTMDPKAQIVGEF |
| Ga0137387_109065573 | 3300012349 | Vadose Zone Soil | MSERTAPVLELQHTAMSGEDALRFLEGHRISRGGRTMDPKAQIVGEF |
| Ga0137386_106199413 | 3300012351 | Vadose Zone Soil | MSDRTAPVLELQHTAMSEQEALRFLEGHRISLGGRTMDP |
| Ga0137366_100900754 | 3300012354 | Vadose Zone Soil | MSERQTVPVLELKHTAMSEEEALRFLDGHRISRGGRTMDPKAQIVGEFVKSI |
| Ga0137390_104693224 | 3300012363 | Vadose Zone Soil | MSELRTHPKLELSHTAMSEEDALRFLDGHRIRLGSRTMDPKAQIVGEFV |
| Ga0137358_101495183 | 3300012582 | Vadose Zone Soil | MSAHPALDMTHTAMSEEDALRFLEGHRIRMGSRTM |
| Ga0157291_104197482 | 3300012902 | Soil | MSDKQTAPTLELAHTAMSEEDALRFLDGHRISRGARTMDPKAQIVGEFVKSIR |
| Ga0137419_101012094 | 3300012925 | Vadose Zone Soil | MSELRTKPTFELAHTAMSEAEALRFLEGHRISLGGRTMDPKAQIV |
| Ga0137416_109276171 | 3300012927 | Vadose Zone Soil | MSDRQAGAATLELAHTMLSEEEALRFLDGQRITRGGRIMDPKAQIVGEF |
| Ga0126369_117714841 | 3300012971 | Tropical Forest Soil | MEDRMSEQKTAPTLELQHTMMSEEEALRFLDGHRIS |
| Ga0157378_126568581 | 3300013297 | Miscanthus Rhizosphere | MTDKQTAPTLELAHTAMSEEDALRFLDGHRISRGARTMDPKAQIVGEFVK |
| Ga0137411_11176252 | 3300015052 | Vadose Zone Soil | MTERSAAATLELAHTVLSEEEALRFLDGHRISRGG |
| Ga0134089_103752561 | 3300015358 | Grasslands Soil | MSERQTAPVLELKHTAMSEEEALRFLDGHRISRGGRTMDPKAQIVGEFVK |
| Ga0134089_105248902 | 3300015358 | Grasslands Soil | MTEQAGTTLELVHTMMDEAEALRFLEGQRISLGSRTM |
| Ga0132257_1008704742 | 3300015373 | Arabidopsis Rhizosphere | MSAHPALDMTHTAMSEEAALSFLEGHRIRMGNRTMDPKAQIVG |
| Ga0132255_1020253311 | 3300015374 | Arabidopsis Rhizosphere | MSDKQTAPTLKLAHTAMSEEDALRFLDGYRISRGPRTMDPKA |
| Ga0182041_105837981 | 3300016294 | Soil | MSTHPTLDLSHTQMSEEEALRVLDGHRITMGGRTM |
| Ga0182037_105268501 | 3300016404 | Soil | MSTHPTLDLSHTQMSEEEALRLLDGHRITVGGRTMDPKAQIVGEFVK |
| Ga0182039_106753291 | 3300016422 | Soil | MSASKTTTTLELAHTAMSEAEALRFLEGQRIRIGGRTMDPKAQ |
| Ga0184604_100421982 | 3300018000 | Groundwater Sediment | MTEKPTLPKLELAHSLLDEAAALAFLAGHRISLGARTMDPRRRSWASS |
| Ga0184638_11302981 | 3300018052 | Groundwater Sediment | MSHGTAPAMTLEHTAMSEAEALKVLDGHRITRSGRTMDPKAQI |
| Ga0184621_102758002 | 3300018054 | Groundwater Sediment | MTEKPTLPKLELAHTMLSEDAALAFLAGHRISLGGRTMDPKAQ |
| Ga0187773_108186071 | 3300018064 | Tropical Peatland | MSKTAPALELAHTQMSEGEALRLLDGHRISRGGRTMDPKAQI |
| Ga0184612_103107771 | 3300018078 | Groundwater Sediment | MSERGTHPALELSHTTMSEEDALRFLDGHRIRLGSRTMDPKAQIV |
| Ga0184639_103730072 | 3300018082 | Groundwater Sediment | MSELRTKPTLELAHTAMSEEEALRFLKGHRISRGGRTMD |
| Ga0137408_11764511 | 3300019789 | Vadose Zone Soil | MSDPSTHPALDISHTSMSEEAALRFLDGHRIRMGSRTMDPRRLRSS |
| Ga0207685_102208821 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTERAATTLELVHTMMDEAEAVRFLEGQRISLGGRTMDPKAQIVGE |
| Ga0207684_107259202 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERMALVLELKHTAMSEEEALRFLEGHRISLGGRT |
| Ga0207689_115774382 | 3300025942 | Miscanthus Rhizosphere | MSTHPTLELSHTAMSEEDALRLLDGHRIKMGDRTMDPKAQIVGEFVK |
| Ga0207712_112359332 | 3300025961 | Switchgrass Rhizosphere | MSETTTGPKLTLEHTQMSEADALAFLGDQRIRRGSRTMDPKAQIVGEFV |
| Ga0207648_115459722 | 3300026089 | Miscanthus Rhizosphere | MSEMPKLELAHTMLSEEDALRVLDGHRISRGGRTMDPKAQI |
| Ga0207648_118694571 | 3300026089 | Miscanthus Rhizosphere | MSEQGTHPKLELAHTAMSEADALRLLEGHRIRRGSRTMYPKA |
| Ga0209236_10311011 | 3300026298 | Grasslands Soil | MSDLRTHPKLELSHTEMSEPDALRFLEGHRIRLGDRTMDPKA |
| Ga0209802_11290473 | 3300026328 | Soil | MSDLRTHPKLELSHTAMSEPDALRFLEGHRIRLGDRTMDPK |
| Ga0209466_10901572 | 3300027646 | Tropical Forest Soil | MSDARAHPKLEISHTAMSEEDALRFLDGHRIRLGHRTMDPKAQIVGEFVKSI |
| Ga0247818_105619291 | 3300028589 | Soil | MSESRTHPTLELAHTLMSEEDALRLLAGHRIRLGSRTMDPKAQ |
| Ga0247827_108392132 | 3300028889 | Soil | MSERGTHPVLELSHAAMSEEDALRFLEGHRIRLGGRTMDPKAQIVG |
| Ga0307498_102464761 | 3300031170 | Soil | MSTHPPLDLSHTAMSEEDALRLLDGHRITMGGRTMDPKP |
| Ga0318528_103255102 | 3300031561 | Soil | MSASKTTTTLELAHTAMSEAEALRFLEGQRIRIGGR |
| Ga0307469_102317362 | 3300031720 | Hardwood Forest Soil | MSEKTAPALELKHTAMSEEEALRLLEGHRISLGGRTMD |
| Ga0307469_125320631 | 3300031720 | Hardwood Forest Soil | DLPKLELAHTLMSEDDALRFLEGHRFSRGGRTMDPKSQIVGEFVR |
| Ga0307405_118054752 | 3300031731 | Rhizosphere | MSERGTHPALELSHTAMSEEEALRFLDGHRIRLGHRTMDPKAQIVGEFVK |
| Ga0307468_1007857351 | 3300031740 | Hardwood Forest Soil | MTERAATTLELVHTMMDEAEAVRFLEGQQISLGGRTMDPKAQIV |
| Ga0310892_102251821 | 3300031858 | Soil | MSERATHPVLELAHTALSEDEALRLLDGHRIRRGSRTMD |
| Ga0318520_107361432 | 3300031897 | Soil | MSTHPTLDLSHTQMSEEEALRLLDGHRITMGGRTMDPKAQ |
| Ga0310902_101338621 | 3300032012 | Soil | MSAHPVLDMTHTALSEEDALRLLDGHRIRMGNRTMDPKAQIVG |
| Ga0318525_100306463 | 3300032089 | Soil | MSTHPILEMSHTAMSEEDALRFLEGHRIRMGSRTMDPK |
| Ga0307471_1008579751 | 3300032180 | Hardwood Forest Soil | MSDERVGATLELAHTMMSETEALGFLEGQRISLGARTMDP |
| Ga0307472_1017180182 | 3300032205 | Hardwood Forest Soil | MSERTAPALELKHTAMSEEEALRFLEGHRISLGGRTMDP |
| Ga0310896_105594192 | 3300032211 | Soil | MSTHPTLDLSHTAMSEEAALRLLDGHRIKMGDRTMD |
| ⦗Top⦘ |