| Basic Information | |
|---|---|
| Family ID | F088623 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.07 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (19.266 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.110 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.862 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF06974 | WS_DGAT_C | 9.17 |
| PF00497 | SBP_bac_3 | 5.50 |
| PF00887 | ACBP | 1.83 |
| PF00515 | TPR_1 | 1.83 |
| PF13483 | Lactamase_B_3 | 0.92 |
| PF00437 | T2SSE | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4281 | Acyl-CoA-binding protein | Lipid transport and metabolism [I] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.08 % |
| Unclassified | root | N/A | 0.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_102678425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 690 | Open in IMG/M |
| 3300005172|Ga0066683_10403846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 844 | Open in IMG/M |
| 3300005290|Ga0065712_10420102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 713 | Open in IMG/M |
| 3300005293|Ga0065715_10931967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 565 | Open in IMG/M |
| 3300005467|Ga0070706_102085100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 513 | Open in IMG/M |
| 3300005568|Ga0066703_10205848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1195 | Open in IMG/M |
| 3300005617|Ga0068859_100982347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 927 | Open in IMG/M |
| 3300005618|Ga0068864_102137238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300005719|Ga0068861_100084997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2485 | Open in IMG/M |
| 3300005994|Ga0066789_10165194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 938 | Open in IMG/M |
| 3300005995|Ga0066790_10222996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 804 | Open in IMG/M |
| 3300006794|Ga0066658_10500289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 661 | Open in IMG/M |
| 3300006806|Ga0079220_10037198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2205 | Open in IMG/M |
| 3300006904|Ga0075424_100196478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2142 | Open in IMG/M |
| 3300006918|Ga0079216_11678497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 541 | Open in IMG/M |
| 3300009075|Ga0105090_10301776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 981 | Open in IMG/M |
| 3300009091|Ga0102851_12469960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300009147|Ga0114129_11869105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300009179|Ga0115028_11194898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300009545|Ga0105237_10708139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1013 | Open in IMG/M |
| 3300010360|Ga0126372_10751777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 959 | Open in IMG/M |
| 3300010397|Ga0134124_10356775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1379 | Open in IMG/M |
| 3300012201|Ga0137365_10709769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
| 3300012202|Ga0137363_11557415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300012209|Ga0137379_10576394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1032 | Open in IMG/M |
| 3300012209|Ga0137379_10886124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 797 | Open in IMG/M |
| 3300012354|Ga0137366_10514950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 863 | Open in IMG/M |
| 3300012359|Ga0137385_10547288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 977 | Open in IMG/M |
| 3300012361|Ga0137360_10652116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
| 3300012532|Ga0137373_10699562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
| 3300012582|Ga0137358_10674444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
| 3300012987|Ga0164307_10306706 | Not Available | 1134 | Open in IMG/M |
| 3300014261|Ga0075360_1155586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300014319|Ga0075348_1190567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300014969|Ga0157376_11044872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 841 | Open in IMG/M |
| 3300017965|Ga0190266_10871588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300017974|Ga0187777_10821186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 665 | Open in IMG/M |
| 3300018429|Ga0190272_12261415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300018476|Ga0190274_10368285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1376 | Open in IMG/M |
| 3300019279|Ga0184642_1584524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300020006|Ga0193735_1140003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300021086|Ga0179596_10729994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300021432|Ga0210384_10692968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 912 | Open in IMG/M |
| 3300021560|Ga0126371_10295382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1746 | Open in IMG/M |
| 3300025461|Ga0208851_1089645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300025901|Ga0207688_10191418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1223 | Open in IMG/M |
| 3300025903|Ga0207680_10926262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300025905|Ga0207685_10024339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2075 | Open in IMG/M |
| 3300025907|Ga0207645_10066244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2309 | Open in IMG/M |
| 3300025910|Ga0207684_11631290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300025923|Ga0207681_10091502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2173 | Open in IMG/M |
| 3300025923|Ga0207681_10879730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 750 | Open in IMG/M |
| 3300025925|Ga0207650_10056818 | All Organisms → cellular organisms → Bacteria | 2909 | Open in IMG/M |
| 3300025937|Ga0207669_11598140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300025939|Ga0207665_11563449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300025941|Ga0207711_10900579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 822 | Open in IMG/M |
| 3300026067|Ga0207678_10870705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300026088|Ga0207641_11021354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 824 | Open in IMG/M |
| 3300026331|Ga0209267_1012593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 4509 | Open in IMG/M |
| 3300027727|Ga0209328_10187495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300027765|Ga0209073_10016765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2095 | Open in IMG/M |
| 3300027890|Ga0209496_10623057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300027899|Ga0209668_10187899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1278 | Open in IMG/M |
| 3300027900|Ga0209253_10187559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1658 | Open in IMG/M |
| 3300027907|Ga0207428_10755459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 693 | Open in IMG/M |
| 3300028381|Ga0268264_11976303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300028679|Ga0302169_10065626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 853 | Open in IMG/M |
| 3300028739|Ga0302205_10171620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300028743|Ga0302262_10093576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1032 | Open in IMG/M |
| 3300028868|Ga0302163_10248756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300029923|Ga0311347_10340635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 914 | Open in IMG/M |
| 3300029981|Ga0302293_10235157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300029984|Ga0311332_10000934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 15920 | Open in IMG/M |
| 3300029990|Ga0311336_10189246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1674 | Open in IMG/M |
| 3300029990|Ga0311336_11399336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300030000|Ga0311337_10178848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1733 | Open in IMG/M |
| 3300030014|Ga0302175_10148197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300030048|Ga0302273_1079800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 970 | Open in IMG/M |
| 3300030048|Ga0302273_1097042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
| 3300030294|Ga0311349_10023969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5500 | Open in IMG/M |
| 3300030294|Ga0311349_10505505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1143 | Open in IMG/M |
| 3300030294|Ga0311349_12171304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300030339|Ga0311360_10433675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1056 | Open in IMG/M |
| 3300031170|Ga0307498_10354079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300031232|Ga0302323_100197574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2030 | Open in IMG/M |
| 3300031232|Ga0302323_101080675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 893 | Open in IMG/M |
| 3300031521|Ga0311364_11195701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 755 | Open in IMG/M |
| 3300031720|Ga0307469_12155027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300031726|Ga0302321_100022022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5927 | Open in IMG/M |
| 3300031726|Ga0302321_101208384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 866 | Open in IMG/M |
| 3300031902|Ga0302322_101641105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 786 | Open in IMG/M |
| 3300031903|Ga0307407_10592481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 824 | Open in IMG/M |
| 3300031918|Ga0311367_12252118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300031938|Ga0308175_101754498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300032173|Ga0315268_11667701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300032179|Ga0310889_10700221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300032397|Ga0315287_11865245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300032782|Ga0335082_10498092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1080 | Open in IMG/M |
| 3300032782|Ga0335082_10976770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 711 | Open in IMG/M |
| 3300033419|Ga0316601_102358120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300033482|Ga0316627_101629250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300033513|Ga0316628_102676947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300034125|Ga0370484_0038003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales | 1166 | Open in IMG/M |
| 3300034147|Ga0364925_0421190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300034176|Ga0364931_0213228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300034177|Ga0364932_0108775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1053 | Open in IMG/M |
| 3300034354|Ga0364943_0204737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300034354|Ga0364943_0370556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300034417|Ga0364941_193507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 19.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.50% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.92% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014261 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1026784251 | 3300001213 | Wetland | GAPAAGMSLDHAAYHVLALFAPLLLGDGRALIERLGVDYL* |
| Ga0066683_104038461 | 3300005172 | Soil | RAAETVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL* |
| Ga0065712_104201022 | 3300005290 | Miscanthus Rhizosphere | SFQRIGAHGGGDAAAVSLDRAAYQVLALIAPYLMGDGRALIERLGQDYL* |
| Ga0065715_109319671 | 3300005293 | Miscanthus Rhizosphere | GGGDAAAVSLDRAAYQVLALIAPYLLGDGRALIERLGQDYL* |
| Ga0070706_1020851002 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRAADAVSLERAAYQVLALIAPFLRGNARALLDRLSGDYL* |
| Ga0066703_102058481 | 3300005568 | Soil | ETVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL* |
| Ga0068859_1009823472 | 3300005617 | Switchgrass Rhizosphere | KSGGDEVNLDLAAYHVLALFAPFLLGEGRALVERLGEDYL* |
| Ga0068864_1021372381 | 3300005618 | Switchgrass Rhizosphere | AGGEDVSLDHAAYHVLALFAPFLLGDGRALIERLGEDYL* |
| Ga0068861_1000849974 | 3300005719 | Switchgrass Rhizosphere | PRLDRAAYQVMALVAPFMHGDARALIDRLGDEYL* |
| Ga0066789_101651942 | 3300005994 | Soil | ISYQRIAAQQPDAAAVNLDRAAYQVLSLIAPFLQGTSRTLLDRLSRDYL* |
| Ga0066790_102229961 | 3300005995 | Soil | QPDAEAVSLDRAAYQVLSLIAPFLQGPARALLDRLSQDYL* |
| Ga0066658_105002892 | 3300006794 | Soil | STGERAAQAFSLDRAAYQVLSLIAPFLRGNARALLDRLSRDYL* |
| Ga0079220_100371984 | 3300006806 | Agricultural Soil | GPRGGEHSDRPVNLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL* |
| Ga0075424_1001964784 | 3300006904 | Populus Rhizosphere | GAHGVGSGADMNLDLAAYRVLALFAPFLVGDGRALIERLGEEYL* |
| Ga0079216_116784972 | 3300006918 | Agricultural Soil | LGLDRAAYQVLALIAPFTFGAAHALIERLGERYL* |
| Ga0105090_103017761 | 3300009075 | Freshwater Sediment | AAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL* |
| Ga0102851_124699601 | 3300009091 | Freshwater Wetlands | TARGDAGDIDLGRGAYQVLALIAPFLVGDARALLDRLGRDYL* |
| Ga0114129_118691052 | 3300009147 | Populus Rhizosphere | ETINLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL* |
| Ga0115028_111948981 | 3300009179 | Wetland | RGDAGDIDLGRGAYQVLALIAPFLVGDARALLDRLGRDYL* |
| Ga0105237_107081391 | 3300009545 | Corn Rhizosphere | DQRGQSPSLDRAAYQVLSLIAPFLRGPSRTLLARLSQGYL* |
| Ga0126372_107517772 | 3300010360 | Tropical Forest Soil | AESVSLDRAAYQVLSLIAPFLRGDARALVERLSAEYL* |
| Ga0134124_103567751 | 3300010397 | Terrestrial Soil | MQHSASGEAGDVSLDHAAYHVLALVAPFLTGDGRALIERLGEDYL* |
| Ga0137365_107097691 | 3300012201 | Vadose Zone Soil | RIGYGDNEDQREADAGRAAYQVLALIAPYLLGDARVLLDRLGADYL* |
| Ga0137363_115574152 | 3300012202 | Vadose Zone Soil | AAGERDTEAISLDRAAFQVLSLIAPYLRGSARALVERLSRDYL* |
| Ga0137379_105763941 | 3300012209 | Vadose Zone Soil | ASDSAGAVVSLDRAAYQVLSLIAPFLEGTHRALLDRLSQDYL* |
| Ga0137379_108861242 | 3300012209 | Vadose Zone Soil | AQRSQASVNLDRAVYQVLSLIAPFLRGDDRALLDRLSRDYLH* |
| Ga0137366_105149502 | 3300012354 | Vadose Zone Soil | VNLDRAVYQVLSLIAPFLRGDERALLDRLSRDYLQ* |
| Ga0137385_105472882 | 3300012359 | Vadose Zone Soil | VSLDRAAYQVLSLIAPFLRGDARTLLDRLSHDYL* |
| Ga0137360_106521162 | 3300012361 | Vadose Zone Soil | EAVNLDHAAYQVLSLIAPFLQGSSRALIDRLSQDYL* |
| Ga0137373_106995622 | 3300012532 | Vadose Zone Soil | VSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL* |
| Ga0137358_106744441 | 3300012582 | Vadose Zone Soil | INLDHAAYQVLSLIAPFLRGSARTLLDRLSQNYL* |
| Ga0164307_103067063 | 3300012987 | Soil | SDHRREAPSLDRAAHQVLSLIAPFLRGPSRTLLARLSQGYL* |
| Ga0075360_11555861 | 3300014261 | Natural And Restored Wetlands | GDDPAVSLDRAAYQVLALIAPYLVGDGRALIERLGEDYL* |
| Ga0075348_11905672 | 3300014319 | Natural And Restored Wetlands | PVGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL* |
| Ga0157376_110448721 | 3300014969 | Miscanthus Rhizosphere | TARLDRAAYQVLALIAPFMVGPARALIDRLGSDYL* |
| Ga0190266_108715881 | 3300017965 | Soil | SDAAANLDHAAYHVLALFAPFLVGNDRALLERLGEDYL |
| Ga0187777_108211862 | 3300017974 | Tropical Peatland | ISYQKLSAGEHASDAVSLDRAAYQVLALIAPFLRGDARALVERLSGEYL |
| Ga0190272_122614151 | 3300018429 | Soil | KISVGERPADAVSLDRAAYQVLSLIAPFLRGNARALLDRLSGDYL |
| Ga0190274_103682851 | 3300018476 | Soil | GMSLDRAAYQVLALIAPYLVGDGRALIERLGQDYL |
| Ga0184642_15845242 | 3300019279 | Groundwater Sediment | AEDARLGHAAYQVLGLIAPFLVGDARALVERLGADYVQ |
| Ga0193735_11400032 | 3300020006 | Soil | RIAAQQPDAAAVNLDRAAYQVLSLIAPFMQGPSRALLDRLSQDYL |
| Ga0179596_107299941 | 3300021086 | Vadose Zone Soil | ETGVSLDRAAYQVLSLIAPFLHGDARTLLDRLSHDYL |
| Ga0210384_106929681 | 3300021432 | Soil | DAETVNLDRAAYQVLSLIAPFLQGSSRALLDRLSQDYL |
| Ga0126371_102953823 | 3300021560 | Tropical Forest Soil | LSEGHRQNEGINLDRAAYQVLSLIAPFLRGSARTLLDKLSRDYL |
| Ga0208851_10896451 | 3300025461 | Arctic Peat Soil | GDAAGGGLDRAAYQVLALIAPYLVGDGRALVERLGEEYL |
| Ga0207688_101914181 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | FQRIGAHGGGDAAAVSLDRAAYQVLALIAPYLMGDGRALIERLGQDYL |
| Ga0207680_109262621 | 3300025903 | Switchgrass Rhizosphere | ASADQRGQSPSLDRAAYQVLSLIAPFLRGPSRTLLARLSQGYL |
| Ga0207685_100243391 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RQPPSLDRAAYQVLSLIAPFLRGPSRTLLARLSQGYL |
| Ga0207645_100662441 | 3300025907 | Miscanthus Rhizosphere | DVSLDHAAYHVLALVAPFLTGDGRALIERLGEDYL |
| Ga0207684_116312901 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YQRISAGQRAADAVSLERAAYQVLALIAPFLRGNARALLDRLSGDYL |
| Ga0207681_100915021 | 3300025923 | Switchgrass Rhizosphere | AGDVSLDHAAYHVLALVAPFLTGDGRALIERLGEDYL |
| Ga0207681_108797301 | 3300025923 | Switchgrass Rhizosphere | GEAGAPRLDRAAYQVMALVAPFMHGDARALIDRLGDEYL |
| Ga0207650_100568181 | 3300025925 | Switchgrass Rhizosphere | RIGGHGGGDAAAVSLDRAAYQVLALIAPYLLGDGRALIERLGQDYL |
| Ga0207669_115981401 | 3300025937 | Miscanthus Rhizosphere | ETPRLDRAAYQVMALVAPFMHGDARALIDRLGDEYL |
| Ga0207665_115634491 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VANLDRAAYQVLSIIAPFLRGDARALVERLGEEYL |
| Ga0207711_109005792 | 3300025941 | Switchgrass Rhizosphere | GAQLGFAAYHVLALIAPYLRGADRALIERLGSDYLG |
| Ga0207678_108707052 | 3300026067 | Corn Rhizosphere | GDAAAVSLDRAAYQVLALIAPYLMGDGRALIERLGQDYL |
| Ga0207641_110213542 | 3300026088 | Switchgrass Rhizosphere | GRAHGAAGAEDVSLDHAAFHVLALFAPFLLGDGRALIERLGEDYL |
| Ga0209267_10125931 | 3300026331 | Soil | ISAGERAAETVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL |
| Ga0209328_101874951 | 3300027727 | Forest Soil | ETVNLDRAAYQVLSLIAPFLQGSPRALIDRLSQDYL |
| Ga0209073_100167651 | 3300027765 | Agricultural Soil | ISSGEHSDRPVNLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL |
| Ga0209496_106230571 | 3300027890 | Wetland | GDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL |
| Ga0209668_101878991 | 3300027899 | Freshwater Lake Sediment | VEAQSARLDHAAYQVMALVAPFMLGEARTLIDRLGGEYLQGG |
| Ga0209253_101875591 | 3300027900 | Freshwater Lake Sediment | PPGRSVGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL |
| Ga0207428_107554591 | 3300027907 | Populus Rhizosphere | RISSTPVDQGDGDTATARLDRAAYQVLALIAPFMVGSARALIDRLGSGYL |
| Ga0268264_119763031 | 3300028381 | Switchgrass Rhizosphere | QFDVSLDHAAYHVLALVAPFLVGEGRALIERLGEDYL |
| Ga0302169_100656262 | 3300028679 | Fen | TYWMSYQQISAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302205_101716202 | 3300028739 | Fen | DAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302262_100935763 | 3300028743 | Fen | GDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302163_102487562 | 3300028868 | Fen | TGDGKGSAGTLNLDRAAYQVLSLIAPFLLGSTRTLLDRLSQDYL |
| Ga0311347_103406352 | 3300029923 | Fen | DAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302293_102351571 | 3300029981 | Fen | GDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0311332_100009341 | 3300029984 | Fen | RIGAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0311336_101892463 | 3300029990 | Fen | AADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0311336_113993361 | 3300029990 | Fen | RVRSRHGPEDAGGDAAGGGLDHAAYQVLALIAPYLVGDGRALVERLGEEYL |
| Ga0311337_101788483 | 3300030000 | Fen | VLEVVDGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302175_101481971 | 3300030014 | Fen | IATGDGKGSAGTLNLDRAAYQVLSLIAPFLLGRTRTLFDRLSQDYL |
| Ga0302273_10798002 | 3300030048 | Bog | GNAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302273_10970421 | 3300030048 | Bog | DGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0311349_100239696 | 3300030294 | Fen | RSRHGPEDAGGDAAGGGLDRAAYQVLALIAPYLVGDGRALVERLGEEYL |
| Ga0311349_105055053 | 3300030294 | Fen | AHHGGDGNAAAVSLDRAAYQVLALVAPFLVGDGRALIERLGQDYL |
| Ga0311349_121713042 | 3300030294 | Fen | TGEGKGSAGTINLDRAAYQVLSLIAPFLRGSTRRLLDRISQDYL |
| Ga0311360_104336752 | 3300030339 | Bog | MSYQRIGAHHGGDGDAAAVSLDRAAYQVLALVAPFLVGDGRALIERLGQDYL |
| Ga0307498_103540791 | 3300031170 | Soil | IAMNGGKEPAGAINLDRAAYQVLSLIAPFLLGRTRTLLDRLSQDYL |
| Ga0302323_1001975741 | 3300031232 | Fen | IGTHHGGDAAAVSLDRAAYQVLALVAPFLVGDGRALIERLGQDYL |
| Ga0302323_1010806751 | 3300031232 | Fen | TYWMSYQRIGAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0311364_111957011 | 3300031521 | Fen | HGGDAADGDAAVSLDRAAYQVLALIAPYLVGDGRALIERLGQDYL |
| Ga0307469_121550271 | 3300031720 | Hardwood Forest Soil | RISAQQPDAAAVNLDRAAYQVLSLIAPFMQGPSRALLDRLSQDYL |
| Ga0302321_1000220227 | 3300031726 | Fen | AAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0302321_1012083842 | 3300031726 | Fen | WMSFQRIGAHRGGDAVDGGEAAISLDRAAYQVLALIAPYLIGESRVLIERLGEDYL |
| Ga0302322_1016411052 | 3300031902 | Fen | WMSYQRIGAHHGGDTADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL |
| Ga0307407_105924811 | 3300031903 | Rhizosphere | HMSLDRAAYQVLALIAPFAVGESRALIESLGERYFRV |
| Ga0311367_122521181 | 3300031918 | Fen | QGGDEANDEKAAVRLDRAAYQVLALIAPYLVGDGRALIERLGEDYL |
| Ga0308175_1017544982 | 3300031938 | Soil | GTQASAGHAVNLDNAAYNVLALFAPFLQGEDRALLARLGEDYL |
| Ga0315268_116677012 | 3300032173 | Sediment | AHHGGDAADGDAAAVSLDRAAYQVLALIAPFLEGDGRALIERLGQDYL |
| Ga0310889_107002212 | 3300032179 | Soil | DTATARLDRAAYQVLALIAPFMVGSARALIDRLGSDYL |
| Ga0315287_118652451 | 3300032397 | Sediment | HHGGDAVDLNDAAVSLDRAAYQVLALIAPYLVGDGRALIERLGEDYL |
| Ga0335082_104980923 | 3300032782 | Soil | RTGGQASAVVSLDRAAYQVLALIAPFLRGDARALVERLGAEYL |
| Ga0335082_109767701 | 3300032782 | Soil | PGLDRAAYQVLALISPYLQGGDRALIDRLGAEYIRED |
| Ga0316601_1023581201 | 3300033419 | Soil | AMSLERAAYQVLALIAPFTVGSARALIERLGDRYL |
| Ga0316627_1016292501 | 3300033482 | Soil | PQESLDRAAYQVMALIAPFLVGDGRTLIERLGEDYL |
| Ga0316628_1026769472 | 3300033513 | Soil | GRSAGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL |
| Ga0370484_0038003_1056_1166 | 3300034125 | Untreated Peat Soil | EAVNLDRAAYQVLSLIAPFLQGSSRALLDRLSQDYL |
| Ga0364925_0421190_1_114 | 3300034147 | Sediment | AAAVSLDRAAYQVLALIAPYLLGDGRALIERLGQDYL |
| Ga0364931_0213228_517_630 | 3300034176 | Sediment | AAAVSLDRAAYQVLALIAPYLVGDGRALIERLGEDYL |
| Ga0364932_0108775_941_1051 | 3300034177 | Sediment | EAVSLDRAAYQVLALIAPFLRGNARALLARLSRDYL |
| Ga0364943_0204737_580_726 | 3300034354 | Sediment | SYQKIAVGERAAEAVSLDRAAYQVLSLIAPFLRGNARALLDRLSRDYL |
| Ga0364943_0370556_418_549 | 3300034354 | Sediment | DGSEGGEAAVSLDRAAYQVLALIAPYLVGDGRELIEKLGEDYL |
| Ga0364941_193507_386_523 | 3300034417 | Sediment | KLHAGERTADGVDLGRAAYQVLSLVAPFLRGEARSLIDRLSAEYL |
| ⦗Top⦘ |