| Basic Information | |
|---|---|
| Family ID | F088595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPDSN |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 2.75 % |
| % of genes near scaffold ends (potentially truncated) | 92.66 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (96.330 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (33.027 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF05129 | Elf1 | 26.61 |
| PF07690 | MFS_1 | 11.93 |
| PF04075 | F420H2_quin_red | 3.67 |
| PF01988 | VIT1 | 1.83 |
| PF04055 | Radical_SAM | 1.83 |
| PF02403 | Seryl_tRNA_N | 1.83 |
| PF14321 | DUF4382 | 0.92 |
| PF00891 | Methyltransf_2 | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF01243 | Putative_PNPOx | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4888 | Transcription elongation factor Elf1, contains Zn-ribbon domain | Transcription [K] | 26.61 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.83 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 1.83 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.08 % |
| Unclassified | root | N/A | 0.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002120|C687J26616_10021741 | All Organisms → cellular organisms → Archaea | 2421 | Open in IMG/M |
| 3300002485|C687J35088_10177958 | All Organisms → cellular organisms → Archaea | 626 | Open in IMG/M |
| 3300002558|JGI25385J37094_10167110 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 589 | Open in IMG/M |
| 3300002560|JGI25383J37093_10153855 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 609 | Open in IMG/M |
| 3300002561|JGI25384J37096_10050126 | All Organisms → cellular organisms → Archaea | 1588 | Open in IMG/M |
| 3300002562|JGI25382J37095_10031232 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2088 | Open in IMG/M |
| 3300005166|Ga0066674_10408940 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 627 | Open in IMG/M |
| 3300005172|Ga0066683_10867825 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 519 | Open in IMG/M |
| 3300005174|Ga0066680_10564761 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota | 714 | Open in IMG/M |
| 3300005174|Ga0066680_10709296 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 616 | Open in IMG/M |
| 3300005174|Ga0066680_10748125 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 594 | Open in IMG/M |
| 3300005177|Ga0066690_10791458 | All Organisms → cellular organisms → Archaea | 617 | Open in IMG/M |
| 3300005178|Ga0066688_10330542 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 986 | Open in IMG/M |
| 3300005180|Ga0066685_10232635 | All Organisms → cellular organisms → Archaea | 1268 | Open in IMG/M |
| 3300005186|Ga0066676_10306999 | All Organisms → cellular organisms → Archaea | 1051 | Open in IMG/M |
| 3300005186|Ga0066676_11019418 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 549 | Open in IMG/M |
| 3300005445|Ga0070708_100320876 | All Organisms → cellular organisms → Archaea | 1459 | Open in IMG/M |
| 3300005445|Ga0070708_101908899 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 550 | Open in IMG/M |
| 3300005468|Ga0070707_102056180 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 539 | Open in IMG/M |
| 3300005552|Ga0066701_10899609 | All Organisms → cellular organisms → Archaea | 524 | Open in IMG/M |
| 3300005552|Ga0066701_10966592 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300005552|Ga0066701_10970120 | All Organisms → cellular organisms → Archaea | 503 | Open in IMG/M |
| 3300005555|Ga0066692_10882524 | All Organisms → cellular organisms → Archaea | 548 | Open in IMG/M |
| 3300005557|Ga0066704_10118967 | All Organisms → cellular organisms → Archaea | 1750 | Open in IMG/M |
| 3300005557|Ga0066704_10241011 | All Organisms → cellular organisms → Archaea | 1227 | Open in IMG/M |
| 3300005568|Ga0066703_10536135 | All Organisms → cellular organisms → Archaea → TACK group | 690 | Open in IMG/M |
| 3300005586|Ga0066691_10727424 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 587 | Open in IMG/M |
| 3300005598|Ga0066706_10632207 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota | 850 | Open in IMG/M |
| 3300006034|Ga0066656_10589832 | All Organisms → cellular organisms → Archaea | 720 | Open in IMG/M |
| 3300006034|Ga0066656_10703835 | All Organisms → cellular organisms → Archaea | 649 | Open in IMG/M |
| 3300006046|Ga0066652_100189158 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300006796|Ga0066665_10955730 | All Organisms → cellular organisms → Archaea | 660 | Open in IMG/M |
| 3300006796|Ga0066665_11021826 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 633 | Open in IMG/M |
| 3300006797|Ga0066659_11552593 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
| 3300007258|Ga0099793_10201484 | All Organisms → cellular organisms → Archaea | 954 | Open in IMG/M |
| 3300007258|Ga0099793_10207324 | All Organisms → cellular organisms → Archaea → TACK group | 941 | Open in IMG/M |
| 3300007265|Ga0099794_10420084 | All Organisms → cellular organisms → Archaea | 699 | Open in IMG/M |
| 3300009012|Ga0066710_104011716 | All Organisms → cellular organisms → Archaea | 551 | Open in IMG/M |
| 3300009038|Ga0099829_10424733 | All Organisms → cellular organisms → Archaea | 1100 | Open in IMG/M |
| 3300009038|Ga0099829_10525726 | All Organisms → cellular organisms → Archaea | 982 | Open in IMG/M |
| 3300009038|Ga0099829_11308585 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 599 | Open in IMG/M |
| 3300009089|Ga0099828_10741713 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 881 | Open in IMG/M |
| 3300009137|Ga0066709_101817953 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 854 | Open in IMG/M |
| 3300009137|Ga0066709_102237097 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 752 | Open in IMG/M |
| 3300009137|Ga0066709_103766622 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 550 | Open in IMG/M |
| 3300010080|Ga0127448_126728 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 611 | Open in IMG/M |
| 3300010093|Ga0127490_1071130 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 760 | Open in IMG/M |
| 3300010104|Ga0127446_1101981 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 898 | Open in IMG/M |
| 3300010130|Ga0127493_1095763 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 1040 | Open in IMG/M |
| 3300010133|Ga0127459_1000318 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 1384 | Open in IMG/M |
| 3300010142|Ga0127483_1273101 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 604 | Open in IMG/M |
| 3300010304|Ga0134088_10093369 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1413 | Open in IMG/M |
| 3300010329|Ga0134111_10320739 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 649 | Open in IMG/M |
| 3300010333|Ga0134080_10630079 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 525 | Open in IMG/M |
| 3300011269|Ga0137392_10958763 | All Organisms → cellular organisms → Archaea | 703 | Open in IMG/M |
| 3300011269|Ga0137392_10958765 | All Organisms → cellular organisms → Archaea | 703 | Open in IMG/M |
| 3300012096|Ga0137389_11479696 | All Organisms → cellular organisms → Archaea | 575 | Open in IMG/M |
| 3300012199|Ga0137383_11181098 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 551 | Open in IMG/M |
| 3300012201|Ga0137365_10291960 | All Organisms → cellular organisms → Archaea | 1209 | Open in IMG/M |
| 3300012203|Ga0137399_11262847 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012206|Ga0137380_10695452 | All Organisms → cellular organisms → Archaea | 883 | Open in IMG/M |
| 3300012206|Ga0137380_10823984 | All Organisms → cellular organisms → Archaea | 800 | Open in IMG/M |
| 3300012206|Ga0137380_11353729 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 597 | Open in IMG/M |
| 3300012207|Ga0137381_10039467 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3853 | Open in IMG/M |
| 3300012208|Ga0137376_11127666 | All Organisms → cellular organisms → Archaea | 671 | Open in IMG/M |
| 3300012209|Ga0137379_10486180 | All Organisms → cellular organisms → Archaea | 1143 | Open in IMG/M |
| 3300012210|Ga0137378_11594084 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 562 | Open in IMG/M |
| 3300012224|Ga0134028_1040234 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 1009 | Open in IMG/M |
| 3300012349|Ga0137387_10367826 | All Organisms → cellular organisms → Archaea | 1041 | Open in IMG/M |
| 3300012349|Ga0137387_11140475 | All Organisms → cellular organisms → Archaea | 553 | Open in IMG/M |
| 3300012351|Ga0137386_10127605 | All Organisms → cellular organisms → Archaea | 1811 | Open in IMG/M |
| 3300012351|Ga0137386_10351027 | All Organisms → cellular organisms → Archaea | 1061 | Open in IMG/M |
| 3300012351|Ga0137386_10951551 | All Organisms → cellular organisms → Archaea | 613 | Open in IMG/M |
| 3300012356|Ga0137371_11341265 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 527 | Open in IMG/M |
| 3300012357|Ga0137384_10460220 | All Organisms → cellular organisms → Archaea | 1047 | Open in IMG/M |
| 3300012363|Ga0137390_11257977 | All Organisms → cellular organisms → Archaea | 686 | Open in IMG/M |
| 3300012381|Ga0134026_1084286 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 564 | Open in IMG/M |
| 3300012402|Ga0134059_1363157 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 787 | Open in IMG/M |
| 3300012409|Ga0134045_1304288 | All Organisms → cellular organisms → Archaea | 742 | Open in IMG/M |
| 3300012925|Ga0137419_11003819 | All Organisms → cellular organisms → Archaea | 691 | Open in IMG/M |
| 3300014154|Ga0134075_10156367 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 975 | Open in IMG/M |
| 3300015358|Ga0134089_10000267 | All Organisms → cellular organisms → Archaea | 11185 | Open in IMG/M |
| 3300015358|Ga0134089_10047074 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1564 | Open in IMG/M |
| 3300017657|Ga0134074_1016262 | All Organisms → cellular organisms → Archaea | 2432 | Open in IMG/M |
| 3300018431|Ga0066655_10886658 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_53_6 | 609 | Open in IMG/M |
| 3300018468|Ga0066662_11886265 | All Organisms → cellular organisms → Archaea | 625 | Open in IMG/M |
| 3300025159|Ga0209619_10004715 | All Organisms → cellular organisms → Archaea | 9661 | Open in IMG/M |
| 3300025324|Ga0209640_10310768 | All Organisms → cellular organisms → Archaea | 1316 | Open in IMG/M |
| 3300026277|Ga0209350_1002918 | All Organisms → cellular organisms → Archaea | 6477 | Open in IMG/M |
| 3300026296|Ga0209235_1214806 | All Organisms → cellular organisms → Archaea → TACK group | 633 | Open in IMG/M |
| 3300026297|Ga0209237_1015917 | All Organisms → cellular organisms → Archaea | 4389 | Open in IMG/M |
| 3300026298|Ga0209236_1168814 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300026298|Ga0209236_1259386 | All Organisms → cellular organisms → Archaea → TACK group | 569 | Open in IMG/M |
| 3300026309|Ga0209055_1061982 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1580 | Open in IMG/M |
| 3300026326|Ga0209801_1331295 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
| 3300026332|Ga0209803_1146042 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 919 | Open in IMG/M |
| 3300026524|Ga0209690_1114997 | All Organisms → cellular organisms → Archaea → TACK group | 1071 | Open in IMG/M |
| 3300026529|Ga0209806_1102837 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1213 | Open in IMG/M |
| 3300026532|Ga0209160_1025005 | All Organisms → cellular organisms → Archaea | 3893 | Open in IMG/M |
| 3300026536|Ga0209058_1241566 | All Organisms → cellular organisms → Archaea | 646 | Open in IMG/M |
| 3300026537|Ga0209157_1133431 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1135 | Open in IMG/M |
| 3300026540|Ga0209376_1081504 | All Organisms → cellular organisms → Archaea | 1719 | Open in IMG/M |
| 3300026548|Ga0209161_10241263 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 953 | Open in IMG/M |
| 3300027643|Ga0209076_1072476 | All Organisms → cellular organisms → Archaea | 980 | Open in IMG/M |
| 3300027748|Ga0209689_1213305 | All Organisms → cellular organisms → Archaea | 833 | Open in IMG/M |
| 3300027846|Ga0209180_10800657 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 504 | Open in IMG/M |
| 3300027862|Ga0209701_10133204 | Not Available | 1530 | Open in IMG/M |
| 3300027875|Ga0209283_10139881 | All Organisms → cellular organisms → Archaea | 1602 | Open in IMG/M |
| 3300028536|Ga0137415_11457708 | All Organisms → cellular organisms → Archaea | 508 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 33.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002485 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26616_100217412 | 3300002120 | Soil | MSMTNLFKVFEQDLVQSLRDRRATVDRVVNLLTPIFEERKR* |
| C687J35088_101779582 | 3300002485 | Soil | MTNLFKVFEQDLVQSLRDRRATVDRVVNLLTPIFEERKR* |
| JGI25385J37094_101671102 | 3300002558 | Grasslands Soil | FKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKTKG* |
| JGI25383J37093_101538552 | 3300002560 | Grasslands Soil | MSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREKE* |
| JGI25384J37096_100501261 | 3300002561 | Grasslands Soil | TLTNIFKMHEQAVVQGLRDRRATVDRAVNLLTPIYEERKTKIGT* |
| JGI25382J37095_100312322 | 3300002562 | Grasslands Soil | MTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPDSN* |
| Ga0066674_104089401 | 3300005166 | Soil | MTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKVRTD* |
| Ga0066683_108678252 | 3300005172 | Soil | TNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTN* |
| Ga0066680_105647611 | 3300005174 | Soil | PRMTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIFEERKPNSTRTRG* |
| Ga0066680_107092961 | 3300005174 | Soil | MTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKTKG* |
| Ga0066680_107481251 | 3300005174 | Soil | MTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPSNTRTKG* |
| Ga0066690_107914581 | 3300005177 | Soil | SALHPRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPVYEERKTDSN* |
| Ga0066688_103305424 | 3300005178 | Soil | MTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0066685_102326352 | 3300005180 | Soil | FSALHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0066676_103069992 | 3300005186 | Soil | KDAFSALHPRMTMTNIFKIYEKMVVQDLRNRRATVDRMVNLLTPIFDERKN* |
| Ga0066676_110194182 | 3300005186 | Soil | FAPLHPRMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTD* |
| Ga0070708_1003208762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EAFSPLHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNMLTPIFEERNN* |
| Ga0070708_1019088991 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IFKIYEKELVQSLRDRRATVDRVVNLLIPLYEERKPKGGKPKD* |
| Ga0070707_1020561802 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTKTKD* |
| Ga0066701_108996092 | 3300005552 | Soil | HPRMTMTNIFKIYEKIVVQDLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0066701_109665922 | 3300005552 | Soil | PRMSMTNIFKVYEKELVQNLRDRRATLDRVVNLLTPVFEERETK* |
| Ga0066701_109701202 | 3300005552 | Soil | MTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPDLN* |
| Ga0066692_108825241 | 3300005555 | Soil | RMTLTNIFKMHEQAVVQGLRDRRATVDRAVNLLTPIYEERKTKIGT* |
| Ga0066704_101189675 | 3300005557 | Soil | MTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPGSN* |
| Ga0066704_102410113 | 3300005557 | Soil | TMTNIFKVYEKEVVDALRDHRATVDRVVNLLTPIYEERKIRTG* |
| Ga0066703_105361351 | 3300005568 | Soil | ALHPRMSMTNIFKVYEKELVQNLRDRRATLDRVVNLLTPVFEDRESK* |
| Ga0066691_107274242 | 3300005586 | Soil | YEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNDAKTKG* |
| Ga0066706_106322071 | 3300005598 | Soil | LHPRMTMTNIFKVYEKEVVDALRDHRATVDRVVNLLTPIYEERKIRTG* |
| Ga0066656_105898322 | 3300006034 | Soil | EKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKG* |
| Ga0066656_107038352 | 3300006034 | Soil | LTNIFKIYEQELVQSLRDRRATVDRVVNLLIPVYEERKLDGGKTKG* |
| Ga0066652_1001891583 | 3300006046 | Soil | LHPRMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTD* |
| Ga0066665_109557301 | 3300006796 | Soil | HPRMTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIFEERKPNSTRTRG* |
| Ga0066665_110218262 | 3300006796 | Soil | RMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKVRTD* |
| Ga0066659_115525931 | 3300006797 | Soil | TPLHPRMTLTNLFKVYEKELVQSLRDRRAIVDRVVNLLIPVYEERKPNNTRTKA* |
| Ga0099793_102014841 | 3300007258 | Vadose Zone Soil | HPRMTLTNIFKIYEQQLVQSLRDRRATVDRVVNLLIPVYEERKLNGGKTTG* |
| Ga0099793_102073241 | 3300007258 | Vadose Zone Soil | MTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREGKLDC* |
| Ga0099794_104200842 | 3300007265 | Vadose Zone Soil | TNIFKIYEQGLVQSLRDRRATVDRVVNLLIPVYEERKLNGGKTKG* |
| Ga0066710_1040117161 | 3300009012 | Grasslands Soil | SALHPRMTMTNIFKIYEKMVVQDLRDRRAIVDRMVNLLTPIFDERKS |
| Ga0099829_104247332 | 3300009038 | Vadose Zone Soil | FKVYEKDLVQSLRDRRATVDRVVNLLTPIYEERKPKGTE* |
| Ga0099829_105257261 | 3300009038 | Vadose Zone Soil | LVQSLRDRRATVDRVVNLLIPVYEERKLNGGKTKV* |
| Ga0099829_113085851 | 3300009038 | Vadose Zone Soil | PKRFAPLHPRMTLTNIFKIYEQGLVQSLRDRRATVDRVVNLLIPVYEERKPNGGKTKD* |
| Ga0099828_107417131 | 3300009089 | Vadose Zone Soil | RMTMTNIFKIYEKMVVQDLRDRRATVDRVVNLLTPIFDERKN* |
| Ga0066709_1018179531 | 3300009137 | Grasslands Soil | PKDAFSALHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0066709_1022370973 | 3300009137 | Grasslands Soil | IFKVYEKELVQNLRDRRATLDRIVNLLTPVFENREAKTR* |
| Ga0066709_1037666222 | 3300009137 | Grasslands Soil | MFKIYEKKVIDALRDHRATVDRVVNLLTPIYEERKIQTG* |
| Ga0127448_1267281 | 3300010080 | Grasslands Soil | PLHPRMTMTNIFKVYEKELVDALRAHRATVDRVVNLLTPIYEERKIRTD* |
| Ga0127490_10711302 | 3300010093 | Grasslands Soil | VKFIPLHPRMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKVRTD* |
| Ga0127446_11019811 | 3300010104 | Grasslands Soil | PNVRFAPLHPRMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKVRTD* |
| Ga0127493_10957632 | 3300010130 | Grasslands Soil | PLHPRMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTD* |
| Ga0127459_10003181 | 3300010133 | Grasslands Soil | NIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKVRTD* |
| Ga0127483_12731011 | 3300010142 | Grasslands Soil | NIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKS* |
| Ga0134088_100933692 | 3300010304 | Grasslands Soil | YTALHPRMSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREKE* |
| Ga0134111_103207392 | 3300010329 | Grasslands Soil | DAFSALHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0134080_106300792 | 3300010333 | Grasslands Soil | MTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTN* |
| Ga0137392_109587632 | 3300011269 | Vadose Zone Soil | PRMTLTNIFKIYEQGLIQSLRDRRATVDRVVNLLIPVYEERKLNGGKTKV* |
| Ga0137392_109587652 | 3300011269 | Vadose Zone Soil | PRMTLTNIFKIYEQGLIQSLRDRRATVDRVVNLLIPVYEERKLNGGKTKG* |
| Ga0137389_114796962 | 3300012096 | Vadose Zone Soil | HPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNMLTPIFEERKN* |
| Ga0137383_111810981 | 3300012199 | Vadose Zone Soil | LTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKTKG* |
| Ga0137365_102919601 | 3300012201 | Vadose Zone Soil | IYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKAKG* |
| Ga0137399_112628471 | 3300012203 | Vadose Zone Soil | MSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPVFEDREAK* |
| Ga0137380_106954521 | 3300012206 | Vadose Zone Soil | SALHPRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPDSS* |
| Ga0137380_108239842 | 3300012206 | Vadose Zone Soil | SALHPRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPDSN* |
| Ga0137380_113537291 | 3300012206 | Vadose Zone Soil | MTLTNIFKIYEQGLVQSLRDRRATVDRVVNLLIPVYEERKLNGGKTKG* |
| Ga0137381_100394671 | 3300012207 | Vadose Zone Soil | IFKIYEKIVVQDLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0137376_111276661 | 3300012208 | Vadose Zone Soil | NIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKAKG* |
| Ga0137379_104861801 | 3300012209 | Vadose Zone Soil | KIYEKELVQSLRDRRATVDRVVNLLIPVYEERKPNNTRTKA* |
| Ga0137378_115940842 | 3300012210 | Vadose Zone Soil | LHPRMTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPSNTRTKG* |
| Ga0134028_10402341 | 3300012224 | Grasslands Soil | VKFIPLHPRMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTN* |
| Ga0137387_103678261 | 3300012349 | Vadose Zone Soil | IYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKS* |
| Ga0137387_111404751 | 3300012349 | Vadose Zone Soil | MTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKG* |
| Ga0137386_101276051 | 3300012351 | Vadose Zone Soil | SALHPRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPDLN* |
| Ga0137386_103510271 | 3300012351 | Vadose Zone Soil | LTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKS* |
| Ga0137386_109515511 | 3300012351 | Vadose Zone Soil | GSEEAYSPLHPRMTMTNIFKIYEKMVVQNLRDRRATVDRMVNLLTPIFDERKN* |
| Ga0137371_113412651 | 3300012356 | Vadose Zone Soil | EKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKTKG* |
| Ga0137384_104602203 | 3300012357 | Vadose Zone Soil | FKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKS* |
| Ga0137390_112579771 | 3300012363 | Vadose Zone Soil | RYAPLHPRMTLTNIFKIYEQQLVQSLRDRRATVDRVVNLLIPVYEERKLNGGKTKG* |
| Ga0134026_10842861 | 3300012381 | Grasslands Soil | YEKEVVDALRAHRATVDRVVNLLTPIYEERKIRTD* |
| Ga0134059_13631571 | 3300012402 | Grasslands Soil | RMTMTNIFKVYEKEVVDALRARRATVDRVVNLLTPIYEERKIRTN* |
| Ga0134045_13042882 | 3300012409 | Grasslands Soil | MTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKS* |
| Ga0137419_110038191 | 3300012925 | Vadose Zone Soil | IFKIYEKDLVQSLRDRRVTVDRVVNLLTPIFEDKKTDSS* |
| Ga0134075_101563671 | 3300014154 | Grasslands Soil | RMSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPVFEDREAK* |
| Ga0134089_1000026713 | 3300015358 | Grasslands Soil | ALHPRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKPGSN* |
| Ga0134089_100470743 | 3300015358 | Grasslands Soil | ALHPRMSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREKE* |
| Ga0134074_10162621 | 3300017657 | Grasslands Soil | IFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPHNSRTKG |
| Ga0066655_108866581 | 3300018431 | Grasslands Soil | RMTMTNIFKVYEKEVVDALRAHRATVDRVVNLLTPIYEERKVRTD |
| Ga0066662_118862652 | 3300018468 | Grasslands Soil | YEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNSAKTKG |
| Ga0209619_100047157 | 3300025159 | Soil | MSMTNLFKVFEQDLVQSLRDRRATVDRVVNLLTPIFEERKR |
| Ga0209640_103107681 | 3300025324 | Soil | LTNIFKLYEKEVVQGLRDRRATVDRVVNLLTPIYEERKR |
| Ga0209350_10029181 | 3300026277 | Grasslands Soil | LHPRMTLTNIFKIYEKDLVQSLRDRRATVDRVVNLLIPIYEERKPNNTRTKS |
| Ga0209235_12148061 | 3300026296 | Grasslands Soil | PRMSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREKE |
| Ga0209237_10159171 | 3300026297 | Grasslands Soil | HPRMTLTNIFKIYEKDLVQSLRDRRATVDRIVNLLIPIYEERKPNSAKTKG |
| Ga0209236_11688142 | 3300026298 | Grasslands Soil | RMSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREKE |
| Ga0209236_12593861 | 3300026298 | Grasslands Soil | MTNIFKVYEKELVQILRDRRATLDRIVNLLTPIFEDREKE |
| Ga0209055_10619821 | 3300026309 | Soil | PRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERNN |
| Ga0209801_13312951 | 3300026326 | Soil | HPRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKKTDSN |
| Ga0209803_11460423 | 3300026332 | Soil | IFKTYERMVVQDLRDRRATVDRMVNLLTPIFDERKN |
| Ga0209690_11149971 | 3300026524 | Soil | HPRMSMTNIFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDRRKE |
| Ga0209806_11028371 | 3300026529 | Soil | PGPKDAFSALHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN |
| Ga0209160_10250055 | 3300026532 | Soil | IFKVYEKELVQNLRDRRATLDRIVNLLTPIFEDREKE |
| Ga0209058_12415661 | 3300026536 | Soil | LHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN |
| Ga0209157_11334312 | 3300026537 | Soil | ALHPRMSMTNIFKVYEKELVQNLRDRRAALDRIVNLLTPIFEDREKE |
| Ga0209376_10815043 | 3300026540 | Soil | DAFSALHPRMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN |
| Ga0209161_102412631 | 3300026548 | Soil | RMTMTNIFKIYEKMVVQDLRDRRATVDRMVNLLTPIFDERKN |
| Ga0209076_10724763 | 3300027643 | Vadose Zone Soil | PRMTMTNIFKIYEKDLVQSLRDRRATVDRVVNLLTPIYEEKRPDSN |
| Ga0209689_12133053 | 3300027748 | Soil | YEKDLVQSLRDRRATVDRVVNLLIPIYEERKPSNTRTKG |
| Ga0209180_108006571 | 3300027846 | Vadose Zone Soil | RAPGSKEAFSPLHPRMTMTNIFKIYEKMVVQNLRDRRATVDRVVNLLTPIFDERKN |
| Ga0209701_101332043 | 3300027862 | Vadose Zone Soil | KVYEKDLVQSLRDRRATVDRVVNLLTPIYEERKTVSI |
| Ga0209283_101398813 | 3300027875 | Vadose Zone Soil | RMTLTNLFKTYEKDVVQALRDRRASSDRIVNLLTPIYEERAGNRTRNEVQTAKE |
| Ga0137415_114577082 | 3300028536 | Vadose Zone Soil | PRMTMTNIFKIYEKDLVKSLRDRRATVDRVVNLLTPIYEEKKPDSN |
| ⦗Top⦘ |