Basic Information | |
---|---|
Family ID | F088584 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 45 residues |
Representative Sequence | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQS |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 32.11 % |
% of genes near scaffold ends (potentially truncated) | 82.57 % |
% of genes from short scaffolds (< 2000 bps) | 91.74 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (70.642 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.596 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.936 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.037 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.89% β-sheet: 0.00% Coil/Unstructured: 58.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF07366 | SnoaL | 5.50 |
PF00355 | Rieske | 4.59 |
PF10604 | Polyketide_cyc2 | 4.59 |
PF00072 | Response_reg | 1.83 |
PF00903 | Glyoxalase | 1.83 |
PF12697 | Abhydrolase_6 | 1.83 |
PF14588 | YjgF_endoribonc | 0.92 |
PF03358 | FMN_red | 0.92 |
PF07040 | DUF1326 | 0.92 |
PF14224 | DUF4331 | 0.92 |
PF08240 | ADH_N | 0.92 |
PF13450 | NAD_binding_8 | 0.92 |
PF13508 | Acetyltransf_7 | 0.92 |
PF00210 | Ferritin | 0.92 |
PF00296 | Bac_luciferase | 0.92 |
PF02776 | TPP_enzyme_N | 0.92 |
PF01638 | HxlR | 0.92 |
PF07995 | GSDH | 0.92 |
PF02195 | ParBc | 0.92 |
PF02743 | dCache_1 | 0.92 |
PF05199 | GMC_oxred_C | 0.92 |
PF07992 | Pyr_redox_2 | 0.92 |
PF00571 | CBS | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.92 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.92 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.92 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.92 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.92 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.24 % |
Unclassified | root | N/A | 13.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918002|contig02448 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
2140918002|contig05788 | All Organisms → cellular organisms → Archaea | 681 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10006020 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10045543 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300000858|JGI10213J12805_10005245 | All Organisms → cellular organisms → Archaea | 2946 | Open in IMG/M |
3300000858|JGI10213J12805_10983195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter violaceus | 993 | Open in IMG/M |
3300000953|JGI11615J12901_11207081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter violaceus | 539 | Open in IMG/M |
3300004157|Ga0062590_102568069 | All Organisms → cellular organisms → Archaea | 541 | Open in IMG/M |
3300005093|Ga0062594_101118867 | All Organisms → cellular organisms → Archaea | 772 | Open in IMG/M |
3300005289|Ga0065704_10275122 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300005290|Ga0065712_10229549 | All Organisms → cellular organisms → Archaea | 1016 | Open in IMG/M |
3300005332|Ga0066388_103306190 | All Organisms → cellular organisms → Archaea | 824 | Open in IMG/M |
3300005332|Ga0066388_106896472 | All Organisms → cellular organisms → Archaea | 572 | Open in IMG/M |
3300005336|Ga0070680_101361814 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005345|Ga0070692_10268945 | All Organisms → cellular organisms → Archaea | 1028 | Open in IMG/M |
3300005441|Ga0070700_101015809 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005441|Ga0070700_101316657 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005549|Ga0070704_101331189 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300005558|Ga0066698_10383529 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300005562|Ga0058697_10294682 | All Organisms → cellular organisms → Archaea | 771 | Open in IMG/M |
3300005981|Ga0081538_10083319 | All Organisms → cellular organisms → Archaea | 1691 | Open in IMG/M |
3300006796|Ga0066665_11681441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → unclassified Pseudoxanthomonas → Pseudoxanthomonas sp. CF125 | 502 | Open in IMG/M |
3300006845|Ga0075421_101498122 | All Organisms → cellular organisms → Archaea | 738 | Open in IMG/M |
3300006845|Ga0075421_102222191 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus → unclassified Methanoculleus → Methanoculleus sp. MH98A | 578 | Open in IMG/M |
3300006846|Ga0075430_100903533 | All Organisms → cellular organisms → Archaea | 727 | Open in IMG/M |
3300006852|Ga0075433_11087270 | Not Available | 695 | Open in IMG/M |
3300006852|Ga0075433_11666042 | All Organisms → cellular organisms → Archaea | 549 | Open in IMG/M |
3300006854|Ga0075425_101516183 | All Organisms → cellular organisms → Archaea | 757 | Open in IMG/M |
3300006871|Ga0075434_100627462 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300006871|Ga0075434_102544662 | All Organisms → cellular organisms → Archaea | 513 | Open in IMG/M |
3300006876|Ga0079217_11336792 | All Organisms → cellular organisms → Archaea | 556 | Open in IMG/M |
3300006880|Ga0075429_101472843 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus → unclassified Methanoculleus → Methanoculleus sp. MH98A | 592 | Open in IMG/M |
3300007076|Ga0075435_100188723 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300009081|Ga0105098_10587989 | All Organisms → cellular organisms → Archaea | 578 | Open in IMG/M |
3300009100|Ga0075418_10755397 | All Organisms → cellular organisms → Archaea | 1049 | Open in IMG/M |
3300009100|Ga0075418_11167442 | Not Available | 834 | Open in IMG/M |
3300009147|Ga0114129_10454818 | All Organisms → cellular organisms → Archaea | 1679 | Open in IMG/M |
3300009147|Ga0114129_11760296 | All Organisms → cellular organisms → Archaea | 755 | Open in IMG/M |
3300009147|Ga0114129_12925817 | All Organisms → cellular organisms → Archaea | 564 | Open in IMG/M |
3300009147|Ga0114129_12973855 | All Organisms → cellular organisms → Archaea | 558 | Open in IMG/M |
3300009156|Ga0111538_14039415 | All Organisms → cellular organisms → Archaea | 507 | Open in IMG/M |
3300009157|Ga0105092_10379405 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300009840|Ga0126313_10225643 | All Organisms → cellular organisms → Archaea | 1446 | Open in IMG/M |
3300010029|Ga0105074_1065342 | All Organisms → cellular organisms → Archaea | 656 | Open in IMG/M |
3300010036|Ga0126305_10640669 | Not Available | 716 | Open in IMG/M |
3300010037|Ga0126304_10025734 | All Organisms → cellular organisms → Archaea | 3414 | Open in IMG/M |
3300010037|Ga0126304_10691164 | All Organisms → cellular organisms → Archaea | 689 | Open in IMG/M |
3300010039|Ga0126309_10040416 | All Organisms → cellular organisms → Archaea | 2181 | Open in IMG/M |
3300010040|Ga0126308_10093382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1831 | Open in IMG/M |
3300010040|Ga0126308_10160196 | All Organisms → cellular organisms → Archaea → TACK group | 1427 | Open in IMG/M |
3300010040|Ga0126308_10276908 | Not Available | 1098 | Open in IMG/M |
3300010040|Ga0126308_10953715 | All Organisms → cellular organisms → Archaea | 600 | Open in IMG/M |
3300010042|Ga0126314_10429483 | All Organisms → cellular organisms → Archaea → TACK group | 954 | Open in IMG/M |
3300010042|Ga0126314_11213864 | All Organisms → cellular organisms → Archaea | 564 | Open in IMG/M |
3300010044|Ga0126310_10201767 | All Organisms → cellular organisms → Archaea | 1308 | Open in IMG/M |
3300010046|Ga0126384_11085724 | Not Available | 733 | Open in IMG/M |
3300010046|Ga0126384_11115315 | All Organisms → cellular organisms → Archaea | 724 | Open in IMG/M |
3300010048|Ga0126373_13242496 | All Organisms → cellular organisms → Archaea | 506 | Open in IMG/M |
3300010048|Ga0126373_13263820 | All Organisms → cellular organisms → Archaea | 505 | Open in IMG/M |
3300010166|Ga0126306_10002412 | All Organisms → cellular organisms → Archaea | 10519 | Open in IMG/M |
3300010166|Ga0126306_10494629 | Not Available | 966 | Open in IMG/M |
3300010166|Ga0126306_10539747 | Not Available | 925 | Open in IMG/M |
3300010337|Ga0134062_10748081 | All Organisms → cellular organisms → Archaea | 518 | Open in IMG/M |
3300010362|Ga0126377_10485180 | Not Available | 1265 | Open in IMG/M |
3300010366|Ga0126379_12103303 | All Organisms → cellular organisms → Archaea | 666 | Open in IMG/M |
3300010376|Ga0126381_100085747 | All Organisms → cellular organisms → Archaea | 3979 | Open in IMG/M |
3300010376|Ga0126381_100683526 | All Organisms → cellular organisms → Archaea | 1466 | Open in IMG/M |
3300010376|Ga0126381_104306390 | All Organisms → cellular organisms → Archaea | 551 | Open in IMG/M |
3300011269|Ga0137392_11386885 | All Organisms → cellular organisms → Archaea | 562 | Open in IMG/M |
3300012514|Ga0157330_1007066 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300012901|Ga0157288_10403601 | All Organisms → cellular organisms → Archaea | 512 | Open in IMG/M |
3300012904|Ga0157282_10092318 | All Organisms → cellular organisms → Archaea | 833 | Open in IMG/M |
3300012957|Ga0164303_10126253 | All Organisms → cellular organisms → Archaea | 1314 | Open in IMG/M |
3300012971|Ga0126369_10589012 | Not Available | 1181 | Open in IMG/M |
3300012971|Ga0126369_12672837 | Not Available | 583 | Open in IMG/M |
3300013308|Ga0157375_12559816 | All Organisms → cellular organisms → Archaea | 609 | Open in IMG/M |
3300014310|Ga0075331_1173449 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
3300015200|Ga0173480_11158633 | All Organisms → cellular organisms → Archaea | 519 | Open in IMG/M |
3300018027|Ga0184605_10002920 | Not Available | 5836 | Open in IMG/M |
3300018061|Ga0184619_10427827 | Not Available | 594 | Open in IMG/M |
3300018072|Ga0184635_10236149 | All Organisms → cellular organisms → Archaea | 725 | Open in IMG/M |
3300018072|Ga0184635_10246177 | All Organisms → cellular organisms → Archaea | 708 | Open in IMG/M |
3300018466|Ga0190268_11396192 | All Organisms → cellular organisms → Archaea | 599 | Open in IMG/M |
3300018466|Ga0190268_12379422 | Not Available | 502 | Open in IMG/M |
3300018469|Ga0190270_12379900 | All Organisms → cellular organisms → Archaea | 591 | Open in IMG/M |
3300019361|Ga0173482_10147483 | All Organisms → cellular organisms → Archaea | 913 | Open in IMG/M |
3300019767|Ga0190267_10924744 | All Organisms → cellular organisms → Archaea | 601 | Open in IMG/M |
3300019767|Ga0190267_11178263 | Not Available | 559 | Open in IMG/M |
3300019885|Ga0193747_1069704 | All Organisms → cellular organisms → Archaea | 867 | Open in IMG/M |
3300019997|Ga0193711_1025164 | All Organisms → cellular organisms → Archaea | 752 | Open in IMG/M |
3300020003|Ga0193739_1114276 | All Organisms → cellular organisms → Archaea | 673 | Open in IMG/M |
3300020020|Ga0193738_1004890 | All Organisms → cellular organisms → Archaea | 4677 | Open in IMG/M |
3300021560|Ga0126371_11807871 | All Organisms → cellular organisms → Archaea | 732 | Open in IMG/M |
3300025559|Ga0210087_1093252 | All Organisms → cellular organisms → Archaea | 593 | Open in IMG/M |
3300025905|Ga0207685_10742935 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
3300026075|Ga0207708_11296701 | Not Available | 638 | Open in IMG/M |
3300027577|Ga0209874_1122907 | All Organisms → cellular organisms → Archaea | 604 | Open in IMG/M |
3300027636|Ga0214469_1089689 | All Organisms → cellular organisms → Archaea | 909 | Open in IMG/M |
3300027647|Ga0214468_1061778 | All Organisms → cellular organisms → Archaea | 965 | Open in IMG/M |
3300027947|Ga0209868_1021659 | All Organisms → cellular organisms → Archaea | 661 | Open in IMG/M |
3300031228|Ga0299914_10639409 | All Organisms → cellular organisms → Archaea | 905 | Open in IMG/M |
3300031421|Ga0308194_10061927 | All Organisms → cellular organisms → Archaea | 988 | Open in IMG/M |
3300031852|Ga0307410_10584259 | All Organisms → cellular organisms → Archaea | 930 | Open in IMG/M |
3300031911|Ga0307412_10224878 | All Organisms → cellular organisms → Archaea | 1441 | Open in IMG/M |
3300032002|Ga0307416_100030542 | All Organisms → cellular organisms → Archaea | 4044 | Open in IMG/M |
3300032002|Ga0307416_100238910 | All Organisms → cellular organisms → Archaea | 1758 | Open in IMG/M |
3300032126|Ga0307415_101009273 | All Organisms → cellular organisms → Archaea | 774 | Open in IMG/M |
3300034143|Ga0334961_031977 | All Organisms → cellular organisms → Archaea | 901 | Open in IMG/M |
3300034773|Ga0364936_091891 | All Organisms → cellular organisms → Archaea | 590 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.68% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 13.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.01% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.59% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.75% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
Rhizosphere And Bulk Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Rhizosphere And Bulk Soil | 1.83% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.92% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918002 | Rhizosphere and bulk soil microbial communities from the Great Lakes - Sample MSB1 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MSB1_00070430 | 2140918002 | Rhizosphere And Bulk Soil | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYMGSP |
MSB1_00112910 | 2140918002 | Rhizosphere And Bulk Soil | MNTNDIMSQIEMNKAIIQRYFDAYNNKNETIFDEIIS |
AF_2010_repII_A1DRAFT_100060202 | 3300000597 | Forest Soil | MPQIEFNKSIIQHFFEAYNNKNEAIFDKIIGPEYVDHGTSIIYC* |
AF_2010_repII_A1DRAFT_100455433 | 3300000597 | Forest Soil | MNCNNTMSQVETNKAIINRYFEAYNTKNEAIFDEIIA |
JGI10213J12805_100052451 | 3300000858 | Soil | MQYIIRRMNTNETMSQIEMNKAIKRYFEAYNNKNEAIFDEIIA |
JGI10213J12805_109831951 | 3300000858 | Soil | VNKVYYINMNINNDPMSQIELNKAIIQRYFEAYNNKNEAIFEEIISPDYIDH* |
JGI11615J12901_112070811 | 3300000953 | Soil | MCILHQHMNITDRASQIELNKAIIQRYFEAYNNKNEAIFDEIISPD |
Ga0062590_1025680691 | 3300004157 | Soil | MYINESTSLLEINKGIIQRYFAYNSKNETIFDEIISPDYIDHGQSAYM |
Ga0062594_1011188671 | 3300005093 | Soil | MTYYNMDINESTSLLEINKGIIQRYFEAYNSKNETIFDEIIS |
Ga0065704_102751222 | 3300005289 | Switchgrass Rhizosphere | MEVYCIDMNTYNIISQVELNKTIINRYFEAYNNKNDSIFDEIIDSDYIDHGQSAYMGSP* |
Ga0065712_102295492 | 3300005290 | Miscanthus Rhizosphere | MDTNESISQVEINKGIIQRYFEAYNNKNEAIFDEIISPNYIDHGQSAYMG |
Ga0066388_1033061902 | 3300005332 | Tropical Forest Soil | MSQVVETNKTIIKRYFEAYNTKDEAIFDQIIAPDYIDHGQSAYMDSPGKGVAGDLR* |
Ga0066388_1068964721 | 3300005332 | Tropical Forest Soil | MSQVETNKAIINRYFEAYNTKNDSIFDEIIASDYIDHGQSAYMGSPGRGVAGATFSIH* |
Ga0070680_1013618141 | 3300005336 | Corn Rhizosphere | MTYYNMDINESTSLLEINKGIIQRYFEAYNSKNETIFDGIISPDY |
Ga0070692_102689452 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTNESISQVEINKGIIQRYFEAYNNKNEAIFDEIISPNYIDHGQSA |
Ga0070700_1010158092 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQS |
Ga0070700_1013166571 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNNETMSQIEMNKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQS |
Ga0070704_1013311891 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAY |
Ga0066698_103835291 | 3300005558 | Soil | MSRSTNDTVSQIETNKAIIKRYFEAYNNKDEAIFDEIIAPEYVDHGQSAYMGSPGRGVAGAKR |
Ga0058697_102946822 | 3300005562 | Agave | MNTNEIISQIEMNKTVIQRYFEAYNNKDEAIFDEIIAPEYVD |
Ga0081538_100833195 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MYLHQNMNISDTMSSQIDLNKAIIQRYFGAYNNKNAAIF |
Ga0066665_116814411 | 3300006796 | Soil | MNSRAPPTNETMSQIEMNKAVIQRYFDAYNNKNEAIFDEII |
Ga0075421_1014981222 | 3300006845 | Populus Rhizosphere | MNTSEIISQIEMNKTVIQRYFEAYNNKDEAVFDEIIAP* |
Ga0075421_1022221911 | 3300006845 | Populus Rhizosphere | MNRAYYISMNTNETISQIEINKAIIQRYFEAYNNKNETIFDDIISPDY |
Ga0075430_1009035332 | 3300006846 | Populus Rhizosphere | MNRAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYMGSPGRGV |
Ga0075433_110872701 | 3300006852 | Populus Rhizosphere | MNQAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIFDD |
Ga0075433_116660423 | 3300006852 | Populus Rhizosphere | MNTNDIMSQIEMNKAIIQRYFDAYNNKNETIFDEI |
Ga0075425_1015161831 | 3300006854 | Populus Rhizosphere | MNTSEIISQIEMNKTVIQRYFEAYNNKDEAVFDEIIAPEYVDHGQSAYMGSPG |
Ga0075434_1006274621 | 3300006871 | Populus Rhizosphere | MNTNDIMSQIEMNKAIIQRYFDAYNNKNETIFDEII |
Ga0075434_1025446621 | 3300006871 | Populus Rhizosphere | MSRSTNDTVSQIETNKAIIKRYFEAYNNKDEAIFDEIIAPEYVDHGQSAYMGSPG |
Ga0079217_113367921 | 3300006876 | Agricultural Soil | MSQIEMNKAIIQRYFDAYNNKNETIFDEIIFSDYIDHSQTAYLGSPGRGIDG |
Ga0075429_1014728431 | 3300006880 | Populus Rhizosphere | MNRAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSA |
Ga0075435_1001887231 | 3300007076 | Populus Rhizosphere | MNRAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIF |
Ga0105098_105879891 | 3300009081 | Freshwater Sediment | MNSNETMSQVETNKAVIQQYFEAYNTKNEAIFNEIIAPD* |
Ga0075418_107553972 | 3300009100 | Populus Rhizosphere | MDSSKLSSQVETNKGIIQRYFEAFNSKNEAIFDEIISHDYIDHGQSAYMQAPGSGIAGA |
Ga0075418_111674422 | 3300009100 | Populus Rhizosphere | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYM |
Ga0114129_104548183 | 3300009147 | Populus Rhizosphere | MSQIEKNKAVIKRYFEAYNNKDEAILDEIIDPEYVDHGQSAYMGSPGKGVAGAKHDL |
Ga0114129_117602961 | 3300009147 | Populus Rhizosphere | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYMDSPGRG |
Ga0114129_129258171 | 3300009147 | Populus Rhizosphere | MNQAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDI |
Ga0114129_129738551 | 3300009147 | Populus Rhizosphere | MNRAYYISMNTNETISQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTD |
Ga0111538_140394151 | 3300009156 | Populus Rhizosphere | MSQIDLNKAIIQRYFEAYNSKNEAIFDDIISPDYIDN |
Ga0105092_103794051 | 3300009157 | Freshwater Sediment | MSQVEINKAIIQRYFEAYNNKNEAIFDEIIPPDY* |
Ga0126313_102256431 | 3300009840 | Serpentine Soil | MNINDTISQVETNKAIIQCYFEAYNNKNEAIFDEIISPDYIDHG |
Ga0105074_10653421 | 3300010029 | Groundwater Sand | MNTNETMSQIEINKAIIQRYFEAYNNKNATIFDDIISPDYTDHGQSAYMGSPGRGVTGAK |
Ga0126305_106406691 | 3300010036 | Serpentine Soil | MECVLHQHMNTNDTMSQIELNKTIIQHYFEAYNNKNEAIFDDIISPD |
Ga0126304_100257344 | 3300010037 | Serpentine Soil | MNINDTMSQIDLNKTIIQRYFEAYNNKNEAIFDDIISPDYI |
Ga0126304_106911642 | 3300010037 | Serpentine Soil | MKMDDTMSQVDLNKSIIQRYFEAYNTKNEAIFDDIISPDWSDHTGP |
Ga0126309_100404163 | 3300010039 | Serpentine Soil | MNTNDIMSQIEMNKAIIQRYFEAYNNKNETIFDEIISSDYIDHG* |
Ga0126308_100933823 | 3300010040 | Serpentine Soil | MSQIEMNKAIIQRYFDAYNNKNETIFDEIISSDYIDHGQTAYMGSPGRGIDGAKNDLR |
Ga0126308_101601962 | 3300010040 | Serpentine Soil | MKINDTMSQIELNKAIIQRYFEAYNNKNEAIFDEIISPDYV |
Ga0126308_102769081 | 3300010040 | Serpentine Soil | MNINNDTMSHIEVNKAIIQRYFEAYNNKNEAIFDDIISPD |
Ga0126308_109537152 | 3300010040 | Serpentine Soil | MNINDMISQIELNKTIIQRYFEAYNNKNEAILDDIISPDYID* |
Ga0126314_104294832 | 3300010042 | Serpentine Soil | MKINDTMSQIELNKAIIQRYFEAYNNKNEAIFDEIISPDYVD |
Ga0126314_112138641 | 3300010042 | Serpentine Soil | MSQIEMNKAIIQRYFDAYNNKNETIFDEIISSDYIDHGQTAYM |
Ga0126310_102017673 | 3300010044 | Serpentine Soil | MNINETMSQVEINKTIIQRYFEAYNNKNEAIFDDKISPDYIDHGQSAYMGSPGR |
Ga0126384_110857241 | 3300010046 | Tropical Forest Soil | MSQVEINKAIIQRYFEAYKNKNEAIFDEIISTDYIDHGQTSYMGSPG* |
Ga0126384_111153151 | 3300010046 | Tropical Forest Soil | MSQVETNKAIIKLYFEAYNTKNEAIFDEIIAPDYIDHGQS* |
Ga0126373_132424961 | 3300010048 | Tropical Forest Soil | MNAKDSMSHVVETNKTIIKRYFEAYNTKNEAIFDEIIAPD |
Ga0126373_132638201 | 3300010048 | Tropical Forest Soil | MNTSGSMSQVVETNKTIIKHYFEAYNTKNEAIFDEIIAPD* |
Ga0126306_100024129 | 3300010166 | Serpentine Soil | MNTNDIMSQIEMNKATIQRYFDAYNNKNETKEYY* |
Ga0126306_104946293 | 3300010166 | Serpentine Soil | MSQVEINKAIIQRYFEAYNNKNEAIFDEIISPDYI |
Ga0126306_105397472 | 3300010166 | Serpentine Soil | MNTNDIMSRIELNKAIIQRYFDAYNNKNETIFDEIIS |
Ga0134062_107480811 | 3300010337 | Grasslands Soil | MSQIEMNKAVIQRYFDAYNNKNEAIFDEIIAPECSPG |
Ga0126377_104851802 | 3300010362 | Tropical Forest Soil | MSINEIMSQIEKNKVVIKRYFEAYNNKDEAIFDEIISSDY |
Ga0126379_121033031 | 3300010366 | Tropical Forest Soil | MNTSGSMSQVLETNKTIIKHYFEAYNTKNEAIFDEIIAPD* |
Ga0126381_1000857475 | 3300010376 | Tropical Forest Soil | MNCNVIQLSQVETIKAIINRYFEAYNTKNAIFDEIIT |
Ga0126381_1006835262 | 3300010376 | Tropical Forest Soil | MNTDDTMSQVETNKAIINRYFEAYNTKNEAIFDEIIAP |
Ga0126381_1043063903 | 3300010376 | Tropical Forest Soil | MNTDDTMSQVETNKAIINRYFEAYNTKNDAIFDEIIAPAYI |
Ga0137392_113868852 | 3300011269 | Vadose Zone Soil | MNTNDVMSQVEFNKTIIQRYFEAYNNKNEAIFDEIIAPDYIDDGQS |
Ga0157330_10070663 | 3300012514 | Soil | MNTNDIMSQIEMNKAIIQRYFDAYNNKNETIFDEIISSD |
Ga0157288_104036012 | 3300012901 | Soil | MSQIEKNKAVIKRYFEAYNNKDEGILDEIIDPEYVDHGQSAYMGSPGKGVAGAKHDLE |
Ga0157282_100923181 | 3300012904 | Soil | MSQIEKNKAVIKRYFEAYNNKDEGILDEIIDPEYVDHGQSAYMG |
Ga0164303_101262532 | 3300012957 | Soil | MNSNDIISQIEINKAIIQRYFEAYNNKDETIFDEIIATDYIDHGQSAYM |
Ga0126369_105890121 | 3300012971 | Tropical Forest Soil | MNTDDTMSQVETNKSIINRYFEAYNTKNDAIFNSPRLHRP |
Ga0126369_126728371 | 3300012971 | Tropical Forest Soil | MNTDDTMSQVETNKSIINRYFEAYNTKNDAIFNSPRL |
Ga0157375_125598161 | 3300013308 | Miscanthus Rhizosphere | MDTNESISQVEINKGIIQRYFEAYNNKNEAIFDEIISPNYIDHGQSAYM |
Ga0075331_11734491 | 3300014310 | Natural And Restored Wetlands | MNANDMSEIGMNKDIVQRYFEAYNNKNETILDEIISSDYIDHGQSAYM |
Ga0173480_111586331 | 3300015200 | Soil | MSQIEMNKAVIQRYFDAYNNKNEAIFDEIIAPLL* |
Ga0184605_100029201 | 3300018027 | Groundwater Sediment | MDTNESISQVEINKGIIQRYFEAYNNKNETIFDEII |
Ga0184619_104278272 | 3300018061 | Groundwater Sediment | MSQIQLNKEIIQRYFEAYNNKEEAIFDEIIAPDYID |
Ga0184635_102361491 | 3300018072 | Groundwater Sediment | MNRAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYMGSP |
Ga0184635_102461771 | 3300018072 | Groundwater Sediment | MNTNETMSQIDINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYMGSP |
Ga0190268_113961921 | 3300018466 | Soil | MSQVETNKAVIQQYFEAYNTKNEAIFNEIIAQDYIDHGQTAY |
Ga0190268_123794221 | 3300018466 | Soil | MNELSAMNANDTMSKIEMNKSIIQRYFDAYNNKNETIFD |
Ga0190270_123799001 | 3300018469 | Soil | MNELSAMNTNDTMSQIEMNKSIIQRYFDAYNNKNETILDEIISSDYIDHGQSAYMGSPGRGID |
Ga0173482_101474831 | 3300019361 | Soil | MSTNETMSQIEKNKAVIKRYFEAYNNKDEGILDEIIDPEYVDHGQSA |
Ga0190267_109247441 | 3300019767 | Soil | MNTSNTMSQVEINKAIIQRYFEAYNNKNEAIFDEIIPPDY |
Ga0190267_111782632 | 3300019767 | Soil | MNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDI |
Ga0193747_10697041 | 3300019885 | Soil | MNTNDTMSQVEINKAIIQRYFEAYNNKNEAIFDAIIA |
Ga0193711_10251642 | 3300019997 | Soil | MDNNESISQVEINKGIIQRYFEAYNNKNEMIFDEIISPD |
Ga0193739_11142761 | 3300020003 | Soil | MNTNDTTSQIEINKAIIQRYFEAYNNKNETIFDDIISP |
Ga0193738_10048906 | 3300020020 | Soil | MNNNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGSKE |
Ga0126371_118078711 | 3300021560 | Tropical Forest Soil | LKIKYIVLNTNDIISQVEINKAIIQRYFEAYKNKNEAIFDEIISTDYIDHGQTSYMGSPG |
Ga0210087_10932521 | 3300025559 | Natural And Restored Wetlands | MNANDMSQIEMNKDIVQRYFEAYNNKNETILDEIISSDYIDHGQSAYMGSPGRGIGGA |
Ga0207685_107429352 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSTNDTVSQIETNKAIIKRYFEAYNNKDEAIFDEIIAPEYVDHGQSAYMG |
Ga0207708_112967012 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNNETMSQIEMNKAIIQRYFEAYNNKNETIFDDIISPDYTDHG |
Ga0209874_11229072 | 3300027577 | Groundwater Sand | MSQVETNKAVIQRYFEAYTTKNETIFDEIIAPDYIDHGQTAFMGSPGRGVT |
Ga0214469_10896892 | 3300027636 | Soil | VDKSETISQVEANKAVIQRYFEAYNNKNEAIFDEIIYQNCVDHGQSAYM |
Ga0214468_10617782 | 3300027647 | Soil | MNANDMSQIEMNKAIVQRYFEAYNNKNETILDEIISSDYIYHGQSAY |
Ga0209868_10216591 | 3300027947 | Groundwater Sand | MNRAYYISMNTNETMSQIEINKAIIQRYFEAYNNKNETIFDDIISPDYTDHGQSAYMGSPGRGVTG |
Ga0299914_106394091 | 3300031228 | Soil | MNANDMSQIEMNKAIVQRYFEAYNNKNETILDEIISSDYIDHGQSA |
Ga0308194_100619274 | 3300031421 | Soil | EITMNINNTMSQVEINKAIIQRYFEAYNNKNEIIFDEIIAPD |
Ga0307410_105842592 | 3300031852 | Rhizosphere | MNINDTMSQIELNKAIIQRYFEAYNNKNEAIFDDIISPDYIDYGQSAYMTSSIL |
Ga0307412_102248783 | 3300031911 | Rhizosphere | MKINDTMSQVELNKAIIQRYFEAYNSKNEAIFDEEIGSGS |
Ga0307416_1000305421 | 3300032002 | Rhizosphere | VNEVYYISMNINDTMSQVELNKTIIQRYFEAYNNKNEAIFDDIISPD |
Ga0307416_1002389102 | 3300032002 | Rhizosphere | MECVLHQHMNINDTMSQVELNKTIIQRYFEAYNNKNEAIFDDIISPDY |
Ga0307415_1010092731 | 3300032126 | Rhizosphere | MECILHQHMNINDTMSQVELNKAIIQRYFEAYNNKNEAIFDDIISPDY |
Ga0334961_031977_3_116 | 3300034143 | Sub-Biocrust Soil | MNISDTMSQVELNKAIIQRYFEAYNTKNEAIFDDIISP |
Ga0364936_091891_1_105 | 3300034773 | Sediment | MSQVETNTAVIQRYFEAYNTKNETIFDEIIAPDYI |
⦗Top⦘ |