Basic Information | |
---|---|
Family ID | F088554 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 44 residues |
Representative Sequence | MTEKHSWYKAALRRKKIAEAKRLKAARYVEEMNKRANERDTSSNP |
Number of Associated Samples | 62 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 73.39 % |
% of genes near scaffold ends (potentially truncated) | 27.52 % |
% of genes from short scaffolds (< 2000 bps) | 66.97 % |
Associated GOLD sequencing projects | 58 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Predicted Viral (30.275 % of family members) |
NCBI Taxonomy ID | 10239 (predicted) |
Taxonomy | All Organisms → Viruses → Predicted Viral |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.018 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.119 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.046 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF07659 | DUF1599 | 33.94 |
PF02945 | Endonuclease_7 | 15.60 |
PF04545 | Sigma70_r4 | 13.76 |
PF13362 | Toprim_3 | 2.75 |
PF09723 | Zn-ribbon_8 | 2.75 |
PF13481 | AAA_25 | 1.83 |
PF03796 | DnaB_C | 1.83 |
PF01930 | Cas_Cas4 | 1.83 |
PF01807 | zf-CHC2 | 0.92 |
PF13692 | Glyco_trans_1_4 | 0.92 |
PF01555 | N6_N4_Mtase | 0.92 |
PF13578 | Methyltransf_24 | 0.92 |
PF13453 | zf-TFIIB | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.83 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.83 |
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 1.83 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.92 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.92 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.31 % |
Unclassified | root | N/A | 25.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002197|metazooDRAFT_1227496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 744 | Open in IMG/M |
3300002408|B570J29032_108969084 | Not Available | 554 | Open in IMG/M |
3300002470|metazooDRAFT_1326274 | Not Available | 501 | Open in IMG/M |
3300002835|B570J40625_100153549 | All Organisms → Viruses → Predicted Viral | 2620 | Open in IMG/M |
3300003499|JGI25930J51415_1056152 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300004240|Ga0007787_10136821 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
3300005525|Ga0068877_10009307 | All Organisms → cellular organisms → Bacteria | 7304 | Open in IMG/M |
3300005525|Ga0068877_10032273 | All Organisms → Viruses → Predicted Viral | 3578 | Open in IMG/M |
3300005525|Ga0068877_10117519 | All Organisms → Viruses → Predicted Viral | 1653 | Open in IMG/M |
3300005525|Ga0068877_10298064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 933 | Open in IMG/M |
3300005525|Ga0068877_10757917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300005527|Ga0068876_10101216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1717 | Open in IMG/M |
3300005527|Ga0068876_10105917 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
3300005528|Ga0068872_10007485 | Not Available | 7999 | Open in IMG/M |
3300005528|Ga0068872_10370475 | Not Available | 783 | Open in IMG/M |
3300005581|Ga0049081_10042264 | All Organisms → Viruses → Predicted Viral | 1730 | Open in IMG/M |
3300005805|Ga0079957_1004518 | Not Available | 11517 | Open in IMG/M |
3300005805|Ga0079957_1006011 | Not Available | 9771 | Open in IMG/M |
3300006802|Ga0070749_10004684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9060 | Open in IMG/M |
3300006863|Ga0075459_1001682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3553 | Open in IMG/M |
3300006875|Ga0075473_10443072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300008106|Ga0114339_1253241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 553 | Open in IMG/M |
3300008107|Ga0114340_1010534 | All Organisms → Viruses → Predicted Viral | 4598 | Open in IMG/M |
3300008107|Ga0114340_1021182 | All Organisms → Viruses → Predicted Viral | 3063 | Open in IMG/M |
3300008114|Ga0114347_1026145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2688 | Open in IMG/M |
3300008114|Ga0114347_1042037 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300008114|Ga0114347_1190855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 692 | Open in IMG/M |
3300008116|Ga0114350_1030239 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
3300008117|Ga0114351_1009291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7041 | Open in IMG/M |
3300008120|Ga0114355_1141113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 871 | Open in IMG/M |
3300008120|Ga0114355_1144460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Herbiconiux → unclassified Herbiconiux → Herbiconiux sp. CPCC 203386 | 855 | Open in IMG/M |
3300008263|Ga0114349_1240933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300008266|Ga0114363_1007553 | Not Available | 5348 | Open in IMG/M |
3300008266|Ga0114363_1034978 | All Organisms → Viruses → Predicted Viral | 2090 | Open in IMG/M |
3300008266|Ga0114363_1059495 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
3300008266|Ga0114363_1106989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 996 | Open in IMG/M |
3300009169|Ga0105097_10093879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1638 | Open in IMG/M |
3300010156|Ga0068873_1027344 | Not Available | 587 | Open in IMG/M |
3300010156|Ga0068873_1029362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300010354|Ga0129333_10344391 | All Organisms → Viruses | 1327 | Open in IMG/M |
3300010354|Ga0129333_10557735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 998 | Open in IMG/M |
3300010354|Ga0129333_10876882 | Not Available | 761 | Open in IMG/M |
3300010354|Ga0129333_11493226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 554 | Open in IMG/M |
3300010354|Ga0129333_11586670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300013004|Ga0164293_10392338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 937 | Open in IMG/M |
3300014962|Ga0134315_1014618 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
3300019784|Ga0181359_1084317 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
3300019784|Ga0181359_1090047 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300020551|Ga0208360_1054371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300022179|Ga0181353_1056226 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
3300022752|Ga0214917_10023342 | All Organisms → Viruses → Predicted Viral | 4950 | Open in IMG/M |
3300022752|Ga0214917_10234220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 871 | Open in IMG/M |
3300024289|Ga0255147_1006487 | All Organisms → Viruses → Predicted Viral | 2655 | Open in IMG/M |
3300024289|Ga0255147_1044224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 876 | Open in IMG/M |
3300024289|Ga0255147_1061430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 718 | Open in IMG/M |
3300024298|Ga0255178_1000492 | Not Available | 9426 | Open in IMG/M |
3300024354|Ga0255171_1048476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 801 | Open in IMG/M |
3300024500|Ga0255143_1060620 | Not Available | 613 | Open in IMG/M |
3300025445|Ga0208424_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39484 | Open in IMG/M |
3300025445|Ga0208424_1000076 | Not Available | 12707 | Open in IMG/M |
3300025635|Ga0208147_1013646 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
3300027396|Ga0255146_1073932 | Not Available | 707 | Open in IMG/M |
3300027793|Ga0209972_10005482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9323 | Open in IMG/M |
3300027793|Ga0209972_10007085 | Not Available | 7933 | Open in IMG/M |
3300027793|Ga0209972_10007375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7753 | Open in IMG/M |
3300027793|Ga0209972_10008181 | All Organisms → cellular organisms → Bacteria | 7274 | Open in IMG/M |
3300027793|Ga0209972_10012328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5647 | Open in IMG/M |
3300027793|Ga0209972_10019173 | All Organisms → Viruses → Predicted Viral | 4240 | Open in IMG/M |
3300027805|Ga0209229_10016140 | Not Available | 3186 | Open in IMG/M |
3300027805|Ga0209229_10028124 | All Organisms → Viruses → Predicted Viral | 2454 | Open in IMG/M |
3300027806|Ga0209985_10091146 | Not Available | 1586 | Open in IMG/M |
3300027816|Ga0209990_10222399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
3300027899|Ga0209668_10352777 | Not Available | 955 | Open in IMG/M |
3300027917|Ga0209536_103239472 | Not Available | 517 | Open in IMG/M |
3300029930|Ga0119944_1002833 | All Organisms → Viruses → Predicted Viral | 2947 | Open in IMG/M |
3300029930|Ga0119944_1016484 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
3300029933|Ga0119945_1002150 | All Organisms → Viruses → Predicted Viral | 2930 | Open in IMG/M |
3300031758|Ga0315907_10231956 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
3300031758|Ga0315907_11204903 | Not Available | 530 | Open in IMG/M |
3300031787|Ga0315900_10615465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300031787|Ga0315900_10810873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 643 | Open in IMG/M |
3300031787|Ga0315900_10951660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300031857|Ga0315909_10027991 | All Organisms → cellular organisms → Bacteria | 5522 | Open in IMG/M |
3300031857|Ga0315909_10145806 | Not Available | 1959 | Open in IMG/M |
3300031857|Ga0315909_10277590 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
3300031857|Ga0315909_10434709 | Not Available | 928 | Open in IMG/M |
3300031857|Ga0315909_10713794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
3300031951|Ga0315904_10153089 | All Organisms → Viruses → Predicted Viral | 2332 | Open in IMG/M |
3300031951|Ga0315904_10288590 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
3300031951|Ga0315904_10339362 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
3300031951|Ga0315904_10726745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 830 | Open in IMG/M |
3300031951|Ga0315904_10754802 | Not Available | 808 | Open in IMG/M |
3300031951|Ga0315904_11484495 | Not Available | 500 | Open in IMG/M |
3300031963|Ga0315901_10060421 | All Organisms → Viruses → Predicted Viral | 3658 | Open in IMG/M |
3300031963|Ga0315901_10430649 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
3300031963|Ga0315901_10782474 | Not Available | 694 | Open in IMG/M |
3300032050|Ga0315906_10505991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
3300032050|Ga0315906_11078772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 595 | Open in IMG/M |
3300033482|Ga0316627_101407212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300033485|Ga0316626_11016404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
3300033557|Ga0316617_100898926 | Not Available | 857 | Open in IMG/M |
3300034062|Ga0334995_0130072 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
3300034063|Ga0335000_0357162 | Not Available | 882 | Open in IMG/M |
3300034072|Ga0310127_061382 | All Organisms → Viruses → Predicted Viral | 1802 | Open in IMG/M |
3300034072|Ga0310127_189028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 775 | Open in IMG/M |
3300034092|Ga0335010_0095761 | All Organisms → Viruses → Predicted Viral | 1991 | Open in IMG/M |
3300034096|Ga0335025_0005812 | Not Available | 9203 | Open in IMG/M |
3300034103|Ga0335030_0882732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
3300034106|Ga0335036_0021792 | Not Available | 5128 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.02% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 19.27% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 13.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.26% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.42% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.50% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.59% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.83% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.83% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.83% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.83% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.92% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.92% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.92% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002197 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002470 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - FEB 2013 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
metazooDRAFT_12274963 | 3300002197 | Lake | MTEKYSWYKADMRRRQIAKEKKMKADRYVEMMNKRANESDTSRTS* |
B570J29032_1089690842 | 3300002408 | Freshwater | AALRRKKIAEAKTLKAARYVDEMNKRANDKSTAPNTR* |
metazooDRAFT_13262742 | 3300002470 | Lake | MTEKHSWYKAALRRKKIAEAKRLKAARYVEEMNKRANERDTSSNP* |
B570J40625_1001535496 | 3300002835 | Freshwater | MTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRANDKSTAPNTR* |
JGI25930J51415_10561522 | 3300003499 | Freshwater Lake | MTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRAEQYDATHPK* |
Ga0007787_101368212 | 3300004240 | Freshwater Lake | MTEKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANSNATKQE* |
Ga0068877_1000930718 | 3300005525 | Freshwater Lake | MTEKYSWYKAALRRKKIAEAKRLKAARYVEEMNKRANERPTPSRP* |
Ga0068877_100322733 | 3300005525 | Freshwater Lake | LTEKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANDKSTTSNTQ* |
Ga0068877_101175192 | 3300005525 | Freshwater Lake | MTDKYSWYKADQRRKQIAMEKRLKADRYVEEMNKRANGRELQDNDTPVSS* |
Ga0068877_102980643 | 3300005525 | Freshwater Lake | MTEKHSWYKAEQRRKQIAKEKKLKAARYLDEMNKRAEQYDATHPK* |
Ga0068877_107579171 | 3300005525 | Freshwater Lake | MTDKYSWYKADQRRKKIAMEKRLKADRYVEEMNKRAN |
Ga0068876_101012164 | 3300005527 | Freshwater Lake | MTEKHSWYKAALRRKKIQEAKRLKAARYVEEMNKRANEYDTSRNT* |
Ga0068876_101059171 | 3300005527 | Freshwater Lake | MTEKHSWYKAEQRRKQITKEKKLKAARYLDEMNKRAEQYDATHPK* |
Ga0068872_1000748519 | 3300005528 | Freshwater Lake | MTEKHSWYKAALRRKKIEEAKRLKAARYVEEMNKRANEYDTSRNT* |
Ga0068872_103704752 | 3300005528 | Freshwater Lake | MTEKYSWYKAALRRKKIAKAKTLKAARYVDEMNKRANDKSTAPNTR* |
Ga0049081_100422644 | 3300005581 | Freshwater Lentic | MTEKHSWYKAALRRKKIAEAKRMKADRYVDEMNKRANSNATNEK* |
Ga0079957_10045182 | 3300005805 | Lake | MTEKYSWYKAALRRKKITEEKRLKAARYVEEMNKRANEQSTTPRVL* |
Ga0079957_100601121 | 3300005805 | Lake | MTEKYSWYKSALRRKKLAEAKKLKAARYVDEMNKRAEQYDATHPK* |
Ga0070749_1000468410 | 3300006802 | Aqueous | MTEKFSPYKAALRRKKIAEAKKLKAIKYIKDMNKKANKDANV* |
Ga0075459_100168212 | 3300006863 | Aqueous | MTEKYSWYKSALRRKKIAEAKKLKAARYVEEMNKRANEQQPTTPRVL* |
Ga0075473_104430721 | 3300006875 | Aqueous | MTEKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANDKSTTSNTQ* |
Ga0114339_12532411 | 3300008106 | Freshwater, Plankton | FLMTEKYSWYKSALRRKKVAEAKKLKAARYVDEMNKRAEQYDATHPK* |
Ga0114340_101053417 | 3300008107 | Freshwater, Plankton | MTEKYSWYKSALRRKKVAEAKKLKAARYVDEMNKRAEQYDATHPK* |
Ga0114340_102118210 | 3300008107 | Freshwater, Plankton | MIDKYSWYKTALRRKKIAEAKKLKAARYVEMMNKRAEQYDATHPK* |
Ga0114347_10261452 | 3300008114 | Freshwater, Plankton | MTEKYSWYKAALRRKKIAKAKTLKAARYVDEMNKRAEQYDATHPK* |
Ga0114347_10420373 | 3300008114 | Freshwater, Plankton | MTEKHSWYKAALRRKKIEEAKRLKAARYVDEMNKRANDKSTTSNTQ* |
Ga0114347_11908552 | 3300008114 | Freshwater, Plankton | MTEKHSWYKAEQRRKQIAKEKKLKAARYVDEMNKRAEQYDATHPK* |
Ga0114350_10302393 | 3300008116 | Freshwater, Plankton | MTEKHSWYKAALRRKKIAEAKRIKADQYVEMMNKRANSDATKPK* |
Ga0114351_10092917 | 3300008117 | Freshwater, Plankton | MTEKHSWYKAEQRRKQIAKEKKLKAARYVEMMNKRAEQYDATHPK* |
Ga0114355_11411133 | 3300008120 | Freshwater, Plankton | MTEKYSWYKAEQRRKQIAKKKRDKADRYVEEMNKRANDRNTPISS* |
Ga0114355_11444603 | 3300008120 | Freshwater, Plankton | MTEKYSWYKADQRRKQIAKEKREKADRYVEEMNKRA |
Ga0114349_12409333 | 3300008263 | Freshwater, Plankton | MTEKYSWYKAALRRKKIEEAKRLKAARYVEEMNKRA |
Ga0114363_10075533 | 3300008266 | Freshwater, Plankton | MTEKYSWYKAALRRKQIAQAKKEKADRYIEEMNKQANE* |
Ga0114363_10349781 | 3300008266 | Freshwater, Plankton | MTDKHSWYKDALRRKKIAEAKRLKAARYVEEMNKRANDQQTTSNLR* |
Ga0114363_10594952 | 3300008266 | Freshwater, Plankton | MTEKYSWYKADMRRREIAKEKRLKAARYVEEMNKRAEQYDATHPK* |
Ga0114363_11069893 | 3300008266 | Freshwater, Plankton | MTEKHSWYKAALRRKKIEEAKRLKAARYVDEMNKRANDKSTT |
Ga0105097_100938793 | 3300009169 | Freshwater Sediment | MNKKHNWYNAALRRKKIAEAKRLKAARYIDEMNKRANEQHTPSDIRHSS* |
Ga0068873_10273442 | 3300010156 | Freshwater Lake | YKAEQRRKQIAKKKRDKADRYVEEMNKRANDRNTPISS* |
Ga0068873_10293621 | 3300010156 | Freshwater Lake | MTEKHSWYKAEQRRKQIAKEKKLKAARYLDEMNKRAEQYD |
Ga0129333_103443913 | 3300010354 | Freshwater To Marine Saline Gradient | MTDKYSWYKADQRRKKIAMEKRLKADRYVEEMNKRANGRELQDNDTPVSS* |
Ga0129333_105577352 | 3300010354 | Freshwater To Marine Saline Gradient | MTEKHSWYKAALRRKKIAEAKKIKADRYVDEMNKRANEQPTTSRVL* |
Ga0129333_108768821 | 3300010354 | Freshwater To Marine Saline Gradient | RSLLSMTEKHNWYNAALRRKKIAEAKRLKAARYIDEMNKRANEQHTSSDIRHSS* |
Ga0129333_114932263 | 3300010354 | Freshwater To Marine Saline Gradient | MIDKYSWYKADQRRKKIAMEKRLKADRYVEEMNKRANGRELQDNDTPVSS* |
Ga0129333_115866701 | 3300010354 | Freshwater To Marine Saline Gradient | MSEKHSWYKAALRRKKIQEAKRLKAARYVEEMNKRANEYDTSRNT* |
Ga0164293_103923381 | 3300013004 | Freshwater | TPVCSSRKNLMTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRANDESTAPNTR* |
Ga0134315_10146181 | 3300014962 | Surface Water | MTEKFSWYKAALRRKKIAEAKRLKAMKYIEEMNKKAND* |
Ga0181359_10843173 | 3300019784 | Freshwater Lake | MTEKYSWYKAALRRKKIAEAKTLKAARYVDKMNKRAEQYDATHPK |
Ga0181359_10900472 | 3300019784 | Freshwater Lake | MTEKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANSNATKQE |
Ga0208360_10543712 | 3300020551 | Freshwater | MTDKYSWYKAALRRKQIAQAKKEKADRYIEEMNKQANE |
Ga0181353_10562263 | 3300022179 | Freshwater Lake | MTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRANDESTAPNTR |
Ga0214917_100233424 | 3300022752 | Freshwater | MTKKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANERTTSSNP |
Ga0214917_102342202 | 3300022752 | Freshwater | MTEKYSWYKAALRRKKIQEAKRLKAARYVEEMNKRANERTTSSNP |
Ga0255147_10064872 | 3300024289 | Freshwater | MTEKYSWYKADQRRKEIARQKREKADRYVDEMNKRANDKSTTSNTR |
Ga0255147_10442241 | 3300024289 | Freshwater | MTEKYSWYKAALRRKKIQEAKRLKAARYVEEMNKRANERTTSINP |
Ga0255147_10614303 | 3300024289 | Freshwater | MTEKHSWYKAALRRKKIQEAKKLKAARYVEMMNKRAELYDATQQK |
Ga0255178_100049217 | 3300024298 | Freshwater | MTEKYSWYKADQRRKEIARQKRDKADRYVDEMNKRANDKSTTSNTR |
Ga0255171_10484761 | 3300024354 | Freshwater | MTEKYSWYKADQRRKEIARNKREKADRYVDEMNKRANDKSTTSNT |
Ga0255143_10606201 | 3300024500 | Freshwater | ALRRKKIQEAKRLKAARYVEEMNKRANERTTSSNP |
Ga0208424_100000454 | 3300025445 | Aqueous | MTEKFSPYKAALRRKKIAEAKKLKAIKYIKDMNKKANKDANV |
Ga0208424_100007616 | 3300025445 | Aqueous | MTEKYSWYKSALRRKKIAEAKKLKAARYVEEMNKRANEQQPTTPRVL |
Ga0208147_10136461 | 3300025635 | Aqueous | MTEKHSWYKAALRRKKIQEAKRLKAARYVEEMNKRANEYDTS |
Ga0255146_10739323 | 3300027396 | Freshwater | MTEKYSWYKAALRRKKIQEAKRLKAARYVEEMNKRANEYDTSRNT |
Ga0209972_1000548211 | 3300027793 | Freshwater Lake | MTEKHSWYKAEQRRKQIAKEKKLKAARYLDEMNKRAEQYDATHPK |
Ga0209972_100070853 | 3300027793 | Freshwater Lake | MTDKYSWYKADQRRKQIAMEKRLKADRYVEEMNKRANGRELQDNDTPVSS |
Ga0209972_100073753 | 3300027793 | Freshwater Lake | LTEKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANDKSTTSNTQ |
Ga0209972_100081815 | 3300027793 | Freshwater Lake | MTEKYSWYKAALRRKKIAEAKRLKAARYVEEMNKRANERPTPSRP |
Ga0209972_100123288 | 3300027793 | Freshwater Lake | MTEKYSWYKAEQRRKQIAKKKRDKADRYVEEMNKRANDRNTPISS |
Ga0209972_100191736 | 3300027793 | Freshwater Lake | MTEKHSWYKAALRRKKIEEAKRLKAARYVEEMNKRANEYDTSRNT |
Ga0209229_100161403 | 3300027805 | Freshwater And Sediment | MTSKKEEHNWYNAHLRRKKIAEAKRMKAARYLEEMNKRAEEYDRNTSNAQ |
Ga0209229_100281245 | 3300027805 | Freshwater And Sediment | MTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRANDESTASNTR |
Ga0209985_100911464 | 3300027806 | Freshwater Lake | WYKAALRRKKIQEAKRLKAARYVEEMNKRANEYDTSRNT |
Ga0209990_102223993 | 3300027816 | Freshwater Lake | MTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRANDKSTAPNTR |
Ga0209668_103527771 | 3300027899 | Freshwater Lake Sediment | RLIVTEKHSWYKAALRRKKIQEAKRLKAARYVEEMNKRANEYDTSRNT |
Ga0209536_1032394721 | 3300027917 | Marine Sediment | MTEKHSWYKAALRRKKIAEAKRLKANRYVEEMNKRANDQSSTPIT |
Ga0119944_10028332 | 3300029930 | Aquatic | MTEKHSWYKSALRRKKVAEAKKLKAARYVDEMNKRAEQYDATHPK |
Ga0119944_10164841 | 3300029930 | Aquatic | RSGPNYPMNKKHSWYKAALRRKKIAEAKKIKAARYVDEMNKRANDQPITSSIR |
Ga0119945_10021502 | 3300029933 | Aquatic | MTEKYSWYKSALRRKKLAEAKKLKAARYVDEMNKRAEQYDATHPK |
Ga0315907_102319564 | 3300031758 | Freshwater | MTEKYSWYKAALRRKKIAKAKTLKAARYVDEMNKRAEQYDATHPK |
Ga0315907_112049032 | 3300031758 | Freshwater | MTEKYSWYKAALRRKQIAQAKKEKADRYIEEMNKQANE |
Ga0315900_106154651 | 3300031787 | Freshwater | MTEKYSWYKADMRRREIAKEKRLKAARYVEEMNKRAEQ |
Ga0315900_108108733 | 3300031787 | Freshwater | PMTEKYSWYKAALRRKKIEEAKRLKAARYVDEMNKRANSNATKQE |
Ga0315900_109516602 | 3300031787 | Freshwater | MTDKYSWYKADQRRKKIAMEKRLKADRYVEEMNKRANGRELQDNDTPVSSXYCFQRSE |
Ga0315909_1002799111 | 3300031857 | Freshwater | MTEKHSWYKAALRRKKIAEAKRIKADQYVEMMNKRANSDATKPK |
Ga0315909_101458066 | 3300031857 | Freshwater | MTEKYSWYKAALRRKKIAEAKTLKAARYVDEMNKRANDKSTASNTR |
Ga0315909_102775902 | 3300031857 | Freshwater | MTEKYSWYKADMRRREIAKEKRLKAARYVEEMNKRAEQYDATHPK |
Ga0315909_104347093 | 3300031857 | Freshwater | MTEKYSWYKADQRRKQIAKEKREKADRYVEEMNKRANDEPTPPRVL |
Ga0315909_107137943 | 3300031857 | Freshwater | MTKKKDWTPYKAALRRKKIAEAKKLKAARYVEMMNKRAEQYDATHPK |
Ga0315904_101530892 | 3300031951 | Freshwater | MTEKHSWYKAEQRRKQIAKEKKLKAARYLEMMNKRAEQYDATHPK |
Ga0315904_102885902 | 3300031951 | Freshwater | MTDKYSWYKADQRRKKIAMEKRLKADRYVEEMNKRANGRELQDNDTPVSS |
Ga0315904_103393623 | 3300031951 | Freshwater | MTDKYSWYKADQRRKQIAKEKREKAARYVEEMNKRANENRNTSVSS |
Ga0315904_107267452 | 3300031951 | Freshwater | MTEKHSWYKAALRRKKIAEAKRLKAARYVDEMNKRANDQQIASNTR |
Ga0315904_107548021 | 3300031951 | Freshwater | MTEKYSWYKAALRRKQIAQAKKEKADKYIEEMNKQANE |
Ga0315904_114844951 | 3300031951 | Freshwater | LGLSYPMTEKYSWYKADQRRKEIARKKREKADRYVEEMNKRANDQSTTSNP |
Ga0315901_100604213 | 3300031963 | Freshwater | VATEKYSWYKADQRRKEIARKKREKADRYVEEMNKRANDQSTTPITR |
Ga0315901_104306491 | 3300031963 | Freshwater | MTEKYSWYKADQRRKQIAKEKREKADRYVEEMNKRAN |
Ga0315901_107824741 | 3300031963 | Freshwater | WYKADQRRKQIAKEKREKADRYVEEMNKRANDEPTPPRVL |
Ga0315906_105059914 | 3300032050 | Freshwater | MTEKYSWYKADQRRKQIAKEKREKADRYVEEMNKRANE |
Ga0315906_110787721 | 3300032050 | Freshwater | YKSALRRKKVAEAKKLKAARYVDEMNKRAEQYDATHPK |
Ga0316627_1014072123 | 3300033482 | Soil | MTEKHSWYKAALRRKKIAEAKRIKADHYVEMMNKRANSD |
Ga0316626_110164041 | 3300033485 | Soil | MTEKHSWYKDALRRKKIAEAKRLKASRYVEEMNKKANEQHTPSDIR |
Ga0316617_1008989263 | 3300033557 | Soil | MAEKHNWYKAALRRKKIAEAKRLKAARYIDEMNKRANEQHTPSDIRHSS |
Ga0334995_0130072_865_1002 | 3300034062 | Freshwater | MIDKYSWYKTALRRKKIAEAKKLKAARYVEMMNKRAEQYDATHPK |
Ga0335000_0357162_50_172 | 3300034063 | Freshwater | MTEKHNWYNAALRRKKIAEEKKRKAQEYIDEMNRKANERA |
Ga0310127_061382_4_138 | 3300034072 | Fracking Water | MTEKHSWYKAALRRKKIAEAKKIKADRYVEEMNKRANSYAEKSQ |
Ga0310127_189028_2_124 | 3300034072 | Fracking Water | HSWYKAALRRKKIAEAKKIKADRYVEEMNKRANSYAEKSQ |
Ga0335010_0095761_2_118 | 3300034092 | Freshwater | MIDKYSWYKTALRRKKIAEAKKLKAARYVEMMNKRAEQY |
Ga0335025_0005812_7572_7712 | 3300034096 | Freshwater | MTEKYSWYKAALRRKKIAKAKTLKAARYVDEMNKRANDESTAPNTR |
Ga0335030_0882732_249_389 | 3300034103 | Freshwater | MTEKHSWYKAALRRKKIAEAKKIKADRYVEEMNKRANEQPTTSRVL |
Ga0335036_0021792_4085_4222 | 3300034106 | Freshwater | MTEKYSWYKADQRRKEIARKKREKADRYVEEMNKRANDQSTTSNP |
⦗Top⦘ |