Metagenome Family F088514

Basic Information
Family ID	F088514
Family Type	Metagenome
Number of Sequences	109
Average Sequence Length	43 residues
Representative Sequence	AASHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR
Number of Associated Samples	99
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.92 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	96.33 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.57

Most Common Taxonomy
Group	Bacteria (92.661 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (10.092 % of family members)
Environment Ontology (ENVO)	Unclassified (38.532 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.706 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF01970	TctA	90.83
PF07331	TctB	4.59
PF01019	G_glu_transpept	1.83
PF00486	Trans_reg_C	0.92
PF00149	Metallophos	0.92
PF02601	Exonuc_VII_L	0.92

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG1784	TctA family transporter	General function prediction only [R]	90.83
COG3333	TctA family transporter	General function prediction only [R]	90.83
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	1.83
COG1570	Exonuclease VII, large subunit	Replication, recombination and repair [L]	0.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.66 %
Unclassified	root	N/A	7.34 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.66 %
Unclassified	root	N/A	7.34 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.66 %
Unclassified	root	N/A	7.34 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	63.30 %
Unclassified	root	N/A	7.34 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	33.94 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8.26 %
Unclassified	root	N/A	7.34 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.75 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	24.77 %
Unclassified	root	N/A	7.34 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4.59 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3.67 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	2.75 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.34 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3.67 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	3.67 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	2.75 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.83 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.92 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.34 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples	3.67 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.67 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	2.75 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.83 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.83 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.92 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.34 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	3.67 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	3.67 %
Pseudomonas syringae group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group	2.75 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.83 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.83 %
Agrobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium	0.92 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.34 %
Bradyrhizobium sp. DOA9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9	3.67 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	3.67 %
Pseudomonas syringae group genomosp. 1	species subgroup	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1	2.75 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.83 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.83 %
Agrobacterium vitis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium vitis	0.92 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.34 %
Bradyrhizobium sp. DOA9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9	3.67 %
uncultured Acetobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	3.67 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	2.75 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.83 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.83 %
Agrobacterium vitis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium vitis	0.92 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005177\|Ga0066690_10503322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	815	Open in IMG/M
3300005187\|Ga0066675_10022956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3549	Open in IMG/M
3300005218\|Ga0068996_10161541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	558	Open in IMG/M
3300005293\|Ga0065715_10847931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	592	Open in IMG/M
3300005328\|Ga0070676_10792019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	699	Open in IMG/M
3300005334\|Ga0068869_101869050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	538	Open in IMG/M
3300005345\|Ga0070692_10957754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	596	Open in IMG/M
3300005364\|Ga0070673_100467176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1137	Open in IMG/M
3300005437\|Ga0070710_11058367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	594	Open in IMG/M
3300005455\|Ga0070663_101095819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	696	Open in IMG/M
3300005455\|Ga0070663_101370011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	626	Open in IMG/M
3300005468\|Ga0070707_100842415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	881	Open in IMG/M
3300005530\|Ga0070679_100893616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	832	Open in IMG/M
3300005544\|Ga0070686_100753513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	781	Open in IMG/M
3300005547\|Ga0070693_100598028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	796	Open in IMG/M
3300005548\|Ga0070665_102109130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	568	Open in IMG/M
3300005560\|Ga0066670_11036947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	502	Open in IMG/M
3300005578\|Ga0068854_101204188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	679	Open in IMG/M
3300005578\|Ga0068854_101248312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	667	Open in IMG/M
3300005598\|Ga0066706_11297523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	551	Open in IMG/M
3300005719\|Ga0068861_100152014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	1900	Open in IMG/M
3300005764\|Ga0066903_104106302	All Organisms → cellular organisms → Bacteria → Proteobacteria	780	Open in IMG/M
3300005840\|Ga0068870_10681691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	707	Open in IMG/M
3300005844\|Ga0068862_100198627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1807	Open in IMG/M
3300005844\|Ga0068862_101470374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	686	Open in IMG/M
3300005885\|Ga0075284_1058895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	551	Open in IMG/M
3300006804\|Ga0079221_11429927	All Organisms → cellular organisms → Bacteria → Proteobacteria	551	Open in IMG/M
3300006954\|Ga0079219_11268938	All Organisms → cellular organisms → Bacteria → Proteobacteria	645	Open in IMG/M
3300009094\|Ga0111539_11684105	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300009156\|Ga0111538_10358959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1844	Open in IMG/M
3300009162\|Ga0075423_10107746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2917	Open in IMG/M
3300009177\|Ga0105248_10963746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	963	Open in IMG/M
3300010398\|Ga0126383_12353537	All Organisms → cellular organisms → Bacteria	618	Open in IMG/M
3300010400\|Ga0134122_12467690	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300010401\|Ga0134121_10469615	All Organisms → cellular organisms → Bacteria → Proteobacteria	1152	Open in IMG/M
3300011444\|Ga0137463_1134890	All Organisms → cellular organisms → Bacteria → Proteobacteria	929	Open in IMG/M
3300012484\|Ga0157333_1036308	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300012911\|Ga0157301_10404457	All Organisms → cellular organisms → Bacteria → Proteobacteria	530	Open in IMG/M
3300012915\|Ga0157302_10072683	All Organisms → cellular organisms → Bacteria → Proteobacteria	1025	Open in IMG/M
3300012977\|Ga0134087_10356871	All Organisms → cellular organisms → Bacteria	700	Open in IMG/M
3300012986\|Ga0164304_10990933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9	665	Open in IMG/M
3300013100\|Ga0157373_10246512	Not Available	1263	Open in IMG/M
3300013307\|Ga0157372_12010774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9	664	Open in IMG/M
3300013307\|Ga0157372_12169032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9	638	Open in IMG/M
3300013503\|Ga0120127_10010675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	1518	Open in IMG/M
3300014497\|Ga0182008_10538775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	647	Open in IMG/M
3300014875\|Ga0180083_1132842	Not Available	549	Open in IMG/M
3300015197\|Ga0167638_1062810	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300015372\|Ga0132256_100754317	All Organisms → cellular organisms → Bacteria → Proteobacteria	1089	Open in IMG/M
3300015373\|Ga0132257_101973973	All Organisms → cellular organisms → Bacteria → Proteobacteria	752	Open in IMG/M
3300015373\|Ga0132257_102765630	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300015374\|Ga0132255_101680312	All Organisms → cellular organisms → Bacteria → Proteobacteria	963	Open in IMG/M
3300015374\|Ga0132255_106261230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	504	Open in IMG/M
3300016445\|Ga0182038_10914677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9	774	Open in IMG/M
3300018482\|Ga0066669_10340279	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1240	Open in IMG/M
3300025893\|Ga0207682_10461680	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300025901\|Ga0207688_10451352	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300025903\|Ga0207680_10260009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1201	Open in IMG/M
3300025907\|Ga0207645_10243202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1189	Open in IMG/M
3300025912\|Ga0207707_11106748	All Organisms → cellular organisms → Bacteria → Proteobacteria	645	Open in IMG/M
3300025914\|Ga0207671_10375353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	1129	Open in IMG/M
3300025925\|Ga0207650_10511995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	1004	Open in IMG/M
3300025925\|Ga0207650_11204587	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300025930\|Ga0207701_10943545	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300025932\|Ga0207690_10567015	All Organisms → cellular organisms → Bacteria → Proteobacteria	924	Open in IMG/M
3300025938\|Ga0207704_10724519	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300025938\|Ga0207704_11333773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	614	Open in IMG/M
3300025941\|Ga0207711_10207698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	1788	Open in IMG/M
3300025941\|Ga0207711_11643553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	586	Open in IMG/M
3300025950\|Ga0210134_1034645	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300025960\|Ga0207651_10633484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium	937	Open in IMG/M
3300025986\|Ga0207658_12077614	All Organisms → cellular organisms → Bacteria → Proteobacteria	516	Open in IMG/M
3300026059\|Ga0208540_1034418	All Organisms → cellular organisms → Bacteria → Proteobacteria	580	Open in IMG/M
3300026088\|Ga0207641_11013121	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300026121\|Ga0207683_11598700	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300026342\|Ga0209057_1149029	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300027818\|Ga0209706_10576312	Not Available	508	Open in IMG/M
3300027899\|Ga0209668_10871828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	606	Open in IMG/M
3300028379\|Ga0268266_11819790	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300028861\|Ga0302259_1128660	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300029984\|Ga0311332_11311360	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300029987\|Ga0311334_10073425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2475	Open in IMG/M
3300029990\|Ga0311336_10490717	All Organisms → cellular organisms → Bacteria → Proteobacteria	1039	Open in IMG/M
3300030000\|Ga0311337_11265243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	645	Open in IMG/M
3300030003\|Ga0302172_10261992	Not Available	553	Open in IMG/M
3300030019\|Ga0311348_11295532	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300030052\|Ga0302217_10109978	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300030339\|Ga0311360_10166421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	1812	Open in IMG/M
3300030838\|Ga0311335_11287381	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300031232\|Ga0302323_101063822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	900	Open in IMG/M
3300031726\|Ga0302321_102142005	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300031834\|Ga0315290_10946506	All Organisms → cellular organisms → Bacteria → Proteobacteria	728	Open in IMG/M
3300031890\|Ga0306925_11120787	All Organisms → cellular organisms → Bacteria → Proteobacteria	794	Open in IMG/M
3300031996\|Ga0308176_12246949	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300032008\|Ga0318562_10218719	All Organisms → cellular organisms → Bacteria → Proteobacteria	1104	Open in IMG/M
3300032009\|Ga0318563_10024650	All Organisms → cellular organisms → Bacteria	2966	Open in IMG/M
3300032013\|Ga0310906_11381825	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300032068\|Ga0318553_10443704	All Organisms → cellular organisms → Bacteria → Proteobacteria	680	Open in IMG/M
3300032074\|Ga0308173_11270371	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300032174\|Ga0307470_11088387	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300032205\|Ga0307472_100268373	All Organisms → cellular organisms → Bacteria → Proteobacteria	1350	Open in IMG/M
3300032261\|Ga0306920_101111442	Not Available	1146	Open in IMG/M
3300032397\|Ga0315287_12819845	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300033412\|Ga0310810_10853092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium vitis	810	Open in IMG/M
3300033416\|Ga0316622_102228610	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300033416\|Ga0316622_102872652	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300033482\|Ga0316627_100507939	Not Available	1072	Open in IMG/M
3300033488\|Ga0316621_10274990	Not Available	1094	Open in IMG/M
3300034354\|Ga0364943_0084679	Not Available	1091	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	60.55%
Host-Associated	Host-Associated	39.45%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.21%
Plants	Host-Associated → Plants	39.45%
Aquatic	Environmental → Aquatic	7.34%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	41.28%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.60%
Peat	Environmental → Terrestrial → Peat	11.01%
Freshwater	Environmental → Aquatic → Freshwater	3.67%
Marine	Environmental → Aquatic → Marine	1.83%
Sediment	Environmental → Aquatic → Sediment	1.83%
Floodplain	Environmental → Terrestrial → Floodplain	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	28.44%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.76%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	11.01%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.09%
Loam	Environmental → Terrestrial → Soil → Loam	7.34%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.59%
Lake	Environmental → Aquatic → Freshwater → Lake	1.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.83%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.83%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.92%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.92%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.92%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.76%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	11.01%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.09%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	9.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.34%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.42%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.59%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.75%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.83%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.83%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.92%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.92%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.92%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	10.09%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	7.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.59%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.75%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.75%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.83%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.83%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.92%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.92%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.92%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.92%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.92%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.92%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.92%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.92%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.92%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.92%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005218	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005885	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012484	Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300014875	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D	Environmental	Open in IMG/M
3300015197	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025950	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026059	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026342	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028861	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030003	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3	Environmental	Open in IMG/M
3300030019	II_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030052	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3	Environmental	Open in IMG/M
3300030339	III_Bog_N1 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.57
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.57
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F088514

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066690_105033222	3300005177	Soil	TIVLIVLSSAASPEFRPKEALISGVLLAALAVGVFVIALKLQLQIWPWTSGILPWSS*
Ga0066675_100229561	3300005187	Soil	TASHEFRPKEALISGVLFAALAAGVFVFGLNLQLPLWPWSN*
Ga0068996_101615411	3300005218	Natural And Restored Wetlands	LLIVAASAASREFRLRESIVAGCILAAVAVGVFVIGLKLQLPIWPVLR*
Ga0065715_108479311	3300005293	Miscanthus Rhizosphere	ASHEFRFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH*
Ga0070676_107920192	3300005328	Miscanthus Rhizosphere	WMGVALSTVILIVAARAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR*
Ga0068869_1018690502	3300005334	Miscanthus Rhizosphere	ASAGSHEFRPKEAVISGVLLAALAVGVFIVGLSLQLPIWPGQG*
Ga0070692_109577542	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	SREFRPKEALIAGVLLATLAVGVFVVGLKLQLPIWPTFFG*
Ga0070673_1004671762	3300005364	Switchgrass Rhizosphere	SAASREFRPLESAVSGILLAILCISVFVLALKLQLPIWPSFD*
Ga0070710_110583671	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	ASHEFRPRESLIVGVVLAALAVGVFVVGLQLQLPIWPGQQ*
Ga0070663_1010958192	3300005455	Corn Rhizosphere	ILIVLASAGSHEFRPKEAVISGVLLAALAVGVFIVGLSLQLPIWPGQG*
Ga0070663_1013700111	3300005455	Corn Rhizosphere	AVSTVILVVVASAASREFRPREALLSGIVLAALAVGVFVVGLSLQLPIWPGQP*
Ga0070707_1008424151	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	VASSAASGEFRAKEALISGIVLAALVVGVFVIGLKIQLPIWPGSG*
Ga0070679_1008936162	3300005530	Corn Rhizosphere	ALSTVILIVVASAASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQQ*
Ga0070686_1007535132	3300005544	Switchgrass Rhizosphere	ILLIVMSSAASSEFRPKEAVISGILLAVLAVGVFVIGLKLQIGIWPGQR*
Ga0070693_1005980282	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	IVVASAASPEFRPRESLVAGLLLAALAVGVFVVGLQLQLPIWPGQA*
Ga0070665_1021091301	3300005548	Switchgrass Rhizosphere	LSTVILIVAASAASREFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPGQQ*
Ga0066670_110369472	3300005560	Soil	SAASHEFRPKEALISGILLAALAVGVFVLGLKLVIPIWPGSG*
Ga0068854_1012041882	3300005578	Corn Rhizosphere	VILIVAASAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR*
Ga0068854_1012483121	3300005578	Corn Rhizosphere	GASAASHEFRFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH*
Ga0066706_112975231	3300005598	Soil	TIVLIVLSSAASPEFRPKEAFISAVLLAALAVGVFVIGLKLQLQIWPWTSGILPWSS*
Ga0068861_1001520143	3300005719	Switchgrass Rhizosphere	TASAASHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR*
Ga0066903_1041063021	3300005764	Tropical Forest Soil	SPEFRPKESVIAGIALAALSVAVFVIALKLQLPIWPQFD*
Ga0068870_106816912	3300005840	Miscanthus Rhizosphere	STVILIVAASAASREFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPGQQ*
Ga0068862_1001986271	3300005844	Switchgrass Rhizosphere	PRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR*
Ga0068862_1014703742	3300005844	Switchgrass Rhizosphere	RFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH*
Ga0075284_10588951	3300005885	Rice Paddy Soil	LILIVTSSAASREFRPREALLAGIVLATLAVGVFVVGLQIQLPIWPGQD*
Ga0079221_114299271	3300006804	Agricultural Soil	SHEFRPREAVISGVLLAALASLVFIVGLGVQLPIWPLQR*
Ga0079219_112689382	3300006954	Agricultural Soil	IVAASAASHEFRPRESLFVGVLLAALAVGVFVVGLQLQLPIWPGQA*
Ga0111539_116841052	3300009094	Populus Rhizosphere	VASSAASHEFRPKEAVVAGVLLSALAVGVFVIGLSLQLPIWPVLGR*
Ga0111538_103589593	3300009156	Populus Rhizosphere	GAIIVAASAASHEFRPKESVIAGVLLGALAVGVFIIGLKLQLPIWPFQH*
Ga0075423_101077461	3300009162	Populus Rhizosphere	HEFRPREAVMSGVLLAALAVGVFIVGLSLQLPIWPDFS*
Ga0105248_109637462	3300009177	Switchgrass Rhizosphere	VLSSAASAEFRPREAVVSSVLLAAVVVGVFVFGLHLQLPIWPGAK*
Ga0126383_123535371	3300010398	Tropical Forest Soil	FRLKEASISAVLLAALAVGVFVIGLKLQLPVWPWSN*
Ga0134122_124676901	3300010400	Terrestrial Soil	PKEALVSGILLAILAVGVFVIGLKLQIGIWPGAR*
Ga0134121_104696152	3300010401	Terrestrial Soil	SSAASHEFRPKEALVSGILLAILAVGVFVIGLKLQIGIWPGAR*
Ga0137463_11348901	3300011444	Soil	RPKEAVISGILLAMLAVGVFVVGLKLQVPIWPTFLQG*
Ga0157333_10363082	3300012484	Soil	ASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQQ*
Ga0157301_104044572	3300012911	Soil	AASHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR*
Ga0157302_100726831	3300012915	Soil	VASAASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQP*
Ga0134087_103568712	3300012977	Grasslands Soil	VGSSAASPEFRPREALIVGVLLAALAVGVFVIGLKLQLPIWPAFVS*
Ga0164304_109909332	3300012986	Soil	IVTASAASHEFRPRESLVAGVLLAALAVGVFVVGLQLQLPIWPGQD*
Ga0157373_102465122	3300013100	Corn Rhizosphere	FRPRESLVAGLLLSALAVGVFVIGLQLQLPIWPLQP*
Ga0157372_120107742	3300013307	Corn Rhizosphere	EFRPRESLVVGVLLAALAVGVFVVGLQLQLPIWPGQA*
Ga0157372_121690322	3300013307	Corn Rhizosphere	PRESLVVGVLLAALAVGVFVVGLKLQLPIWPGQA*
Ga0120127_100106752	3300013503	Permafrost	VTASAASHEFRPREALIAGVLLAALAVGVFVIGLQLQLPIWPGQA*
Ga0182008_105387752	3300014497	Rhizosphere	LSTVILVVVASAASREFRAREALISGIVLAALAVGVFVVGLSLQLPIWPGQP*
Ga0180083_11328422	3300014875	Soil	ASAASREFRPKESIVAGLLLAALAVGVFVVGLHLQLPIWPTFI*
Ga0167638_10628102	3300015197	Glacier Forefield Soil	ASSTASPEFRPKEALISGILFAALAAGVFIFGLNLQLPLWPWSN*
Ga0132256_1007543171	3300015372	Arabidopsis Rhizosphere	PEFRPKESLVSGMALAVLSIAVFVVALKLQLPIWPSFS*
Ga0132257_1019739731	3300015373	Arabidopsis Rhizosphere	IVTASAASREFRPRESLLAGLVLAALAVSVFVIGLKLQLPIWPGQD*
Ga0132257_1027656302	3300015373	Arabidopsis Rhizosphere	SSAASHEFRPKEAVISGILLSALAVGGFVIGLKLQIGIWPGQR*
Ga0132255_1016803122	3300015374	Arabidopsis Rhizosphere	PRESLIVGVLLAALAVGVFVIGLKLQLPIWPAFVS*
Ga0132255_1062612301	3300015374	Arabidopsis Rhizosphere	PKESVVSGIALAVLTVTVFVLVLKLQLPIWPQFG*
Ga0182038_109146772	3300016445	Soil	FRPLESVVSGIFLAVLSISVFVIALKLQLPIWPSFD
Ga0066669_103402791	3300018482	Grasslands Soil	RPREALIAGILLAALAVGVFVIGLKLQLPIWPAFIR
Ga0207682_104616801	3300025893	Miscanthus Rhizosphere	NWLGLVFSTMLLIVLSSAASTEFRPKEAVISGVLLAALAVGVFIIGLKLQMGIWPGSR
Ga0207688_104513521	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	ILIVAASAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR
Ga0207680_102600091	3300025903	Switchgrass Rhizosphere	EFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR
Ga0207645_102432021	3300025907	Miscanthus Rhizosphere	SAASHEFRPKESVIAGVLLGALAVGVFIIGLKLQLPIWPFQH
Ga0207707_111067482	3300025912	Corn Rhizosphere	LKAFWGRPLSTVLLIVMSSAASHEFRPKEAVISGILLAILAVGVFVIGLKLQ
Ga0207671_103753531	3300025914	Corn Rhizosphere	HEFRPREAVMSGVLLAALAVGVFIVGLSLQLPIWPDFS
Ga0207650_105119952	3300025925	Switchgrass Rhizosphere	ALSTVILIVVASAASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQQ
Ga0207650_112045872	3300025925	Switchgrass Rhizosphere	AASHEFRLKESIIAGLLLSALAVGVFVVGLGVQLPIWPAFLRG
Ga0207701_109435452	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	STVILIVAASAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR
Ga0207690_105670151	3300025932	Corn Rhizosphere	SHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR
Ga0207704_107245191	3300025938	Miscanthus Rhizosphere	ASHEFRPKEAVISGILLAILAVGVFVIGLKLQIGIWPGGH
Ga0207704_113337731	3300025938	Miscanthus Rhizosphere	GASAASHEFRFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH
Ga0207711_102076983	3300025941	Switchgrass Rhizosphere	TEFRPKEAVISGVLLAALAVGVFIIGLKLQMGIWPGSR
Ga0207711_116435532	3300025941	Switchgrass Rhizosphere	VLSSAASAEFRPREAVVSSVLLAAVVVGVFVFGLHLQLPIWPGAK
Ga0210134_10346452	3300025950	Natural And Restored Wetlands	RPREAVISGIALAVLVVGVFAIGLKLQIGIWPGTP
Ga0207651_106334842	3300025960	Switchgrass Rhizosphere	LSTVILIVTASAASSEFRPRESLAAGVLLAALAVGVFVIGLQLQLPIWPLQQ
Ga0207658_120776142	3300025986	Switchgrass Rhizosphere	AARHEFRLKESIISGILLSALAVGVFVIGLSLQLPIWPTFIGG
Ga0208540_10344182	3300026059	Natural And Restored Wetlands	VMASAASHEFRPREAVISGIALAVLVVGVFAIGLKLQIGIWPGTP
Ga0207641_110131211	3300026088	Switchgrass Rhizosphere	AASHEFRPKEAVISGILLAILAVGVFVIGLKLQIGIWPGGH
Ga0207683_115987002	3300026121	Miscanthus Rhizosphere	SAASMEFRPKEALVSGIALAVLSIAVFVIALKLQMPIWPAFD
Ga0209057_11490291	3300026342	Soil	PEFRPREALIAGVLLAALAVGVFVIGLKLQLPIWPAFVS
Ga0209706_105763121	3300027818	Freshwater Sediment	SASREFRPKEALISGVFLSALAVGVFVIGLKLQLPIWPWTR
Ga0209668_108718282	3300027899	Freshwater Lake Sediment	AGLVLSTILLIVMASAASHEYRPREAVISGIALAALAVGVFVIGLKLQIGIWPGAH
Ga0268266_118197901	3300028379	Switchgrass Rhizosphere	LSTVILIVAASAASREFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPGQQ
Ga0302259_11286601	3300028861	Fen	FRLRESIIAGVFLAVLAVGVFIIGLHLQLPIWPEFSR
Ga0311332_113113602	3300029984	Fen	EFRPKEATIAGVLLAALAVGVFVIGLKLQVPIWPTFLQA
Ga0311334_100734253	3300029987	Fen	RPKEAVISGVFLAALAVGVFVVGLKLQLPIWPSFL
Ga0311336_104907171	3300029990	Fen	PEFRPKEAVISGVFLAALAVGVFVVGLKLQLPIWPSFL
Ga0311337_112652431	3300030000	Fen	ASAASHEFRLRESIIAGVFLAVLAVGVFIIGLHLQLPIWPEFSR
Ga0302172_102619922	3300030003	Fen	ASWASPEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG
Ga0311348_112955321	3300030019	Fen	ASPEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG
Ga0302217_101099782	3300030052	Fen	VLASWASPEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG
Ga0311360_101664211	3300030339	Bog	KEALISGVFLAALAVGVFIIGLKLQLPIWPPFLQG
Ga0311335_112873812	3300030838	Fen	FRPRESIIAGVFLAVLAVGVFIIGLHLQLPIWPEFSR
Ga0302323_1010638222	3300031232	Fen	SEFRWKESLVSGVFLAVLAVSVFVIGLKLQLPIWPTFLHG
Ga0302321_1021420051	3300031726	Fen	PEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG
Ga0315290_109465061	3300031834	Sediment	HEFRPREAVISGIALAALAVGVFVIGLKLQIGIWPGAH
Ga0306925_111207871	3300031890	Soil	TVVLIVLASSASPEFRPKESVVSGIALAVLSISVFVIGLKLQLPIWPALG
Ga0308176_122469492	3300031996	Soil	KESIVAGLLLSALAVGVFVVGLGVQLPVWPAFLRG
Ga0318562_102187192	3300032008	Soil	IVNTVGLVFSTIALIVLASSASPEFRPMESLVSGALLAILAVCVFVIGLKLQIGIWPWSS
Ga0318563_100246501	3300032009	Soil	ASSASPEFRPKESVVSGIALAVLSISVFVIGLKLQLPIWPALG
Ga0310906_113818251	3300032013	Soil	AASHEFRPKESVIAGVLLGALAVGVFIIGLKLQLPIWPFQH
Ga0318553_104437042	3300032068	Soil	IVLASSASPEFRPKESVVSGIALAVLSISVFVIGLKLQLPIWPALG
Ga0308173_112703711	3300032074	Soil	SAASHEFRLKESIIAGLLLSALAVGVFVVGLGVQLPIWPTFLRS
Ga0307470_110883871	3300032174	Hardwood Forest Soil	VLASAASPEFRPRESLISGIALAVLSISVFVIALKLQLPIWPAFG
Ga0307472_1002683731	3300032205	Hardwood Forest Soil	VLASSASPEFRPKESIISGIALAALSVAVFVIALKLQLPIWPQFD
Ga0306920_1011114422	3300032261	Soil	IVLASSASPEFRPMESLVSGALLAILAVCVFVIGLKLQIGIWPWSS
Ga0315287_128198451	3300032397	Sediment	AASHEYRPREAVISGIALAALAVGVFVIGLKLQIGIWPGAH
Ga0310810_108530921	3300033412	Soil	AASAASHEFRPRESLVVGVLLAALAVGVFVVGLQLQLPIWPGQA
Ga0316622_1022286102	3300033416	Soil	SREFRPREALVSGALLSALAVGVFVIGLNLQLPIWPGGR
Ga0316622_1028726521	3300033416	Soil	ASAASHEFRPKEAVISGLLLAALAVGVFVIGLKLQIGIWPGSR
Ga0316627_1005079392	3300033482	Soil	SREFRPREALVSGVLLALLAVGVFVVGLKLQLPVWPVLG
Ga0316621_102749902	3300033488	Soil	RPREALVSGVLLALLAVGVFVVGLKLQLPVWPVLG
Ga0364943_0084679_973_1089	3300034354	Sediment	FRWKEALISGGLLAVLAVGVFIIGLKLQLPIWPVFLHG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign