| Basic Information | |
|---|---|
| Family ID | F088514 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AASHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.33 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.661 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (10.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.532 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.706 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01970 | TctA | 90.83 |
| PF07331 | TctB | 4.59 |
| PF01019 | G_glu_transpept | 1.83 |
| PF00486 | Trans_reg_C | 0.92 |
| PF00149 | Metallophos | 0.92 |
| PF02601 | Exonuc_VII_L | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 90.83 |
| COG3333 | TctA family transporter | General function prediction only [R] | 90.83 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.83 |
| COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.66 % |
| Unclassified | root | N/A | 7.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005177|Ga0066690_10503322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 815 | Open in IMG/M |
| 3300005187|Ga0066675_10022956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3549 | Open in IMG/M |
| 3300005218|Ga0068996_10161541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
| 3300005293|Ga0065715_10847931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 592 | Open in IMG/M |
| 3300005328|Ga0070676_10792019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 699 | Open in IMG/M |
| 3300005334|Ga0068869_101869050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300005345|Ga0070692_10957754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 596 | Open in IMG/M |
| 3300005364|Ga0070673_100467176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1137 | Open in IMG/M |
| 3300005437|Ga0070710_11058367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 594 | Open in IMG/M |
| 3300005455|Ga0070663_101095819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300005455|Ga0070663_101370011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 626 | Open in IMG/M |
| 3300005468|Ga0070707_100842415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 881 | Open in IMG/M |
| 3300005530|Ga0070679_100893616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 832 | Open in IMG/M |
| 3300005544|Ga0070686_100753513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 781 | Open in IMG/M |
| 3300005547|Ga0070693_100598028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300005548|Ga0070665_102109130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 568 | Open in IMG/M |
| 3300005560|Ga0066670_11036947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 502 | Open in IMG/M |
| 3300005578|Ga0068854_101204188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 679 | Open in IMG/M |
| 3300005578|Ga0068854_101248312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 667 | Open in IMG/M |
| 3300005598|Ga0066706_11297523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 551 | Open in IMG/M |
| 3300005719|Ga0068861_100152014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 1900 | Open in IMG/M |
| 3300005764|Ga0066903_104106302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300005840|Ga0068870_10681691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300005844|Ga0068862_100198627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1807 | Open in IMG/M |
| 3300005844|Ga0068862_101470374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 686 | Open in IMG/M |
| 3300005885|Ga0075284_1058895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 551 | Open in IMG/M |
| 3300006804|Ga0079221_11429927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300006954|Ga0079219_11268938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300009094|Ga0111539_11684105 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009156|Ga0111538_10358959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1844 | Open in IMG/M |
| 3300009162|Ga0075423_10107746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2917 | Open in IMG/M |
| 3300009177|Ga0105248_10963746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 963 | Open in IMG/M |
| 3300010398|Ga0126383_12353537 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010400|Ga0134122_12467690 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010401|Ga0134121_10469615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300011444|Ga0137463_1134890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300012484|Ga0157333_1036308 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012911|Ga0157301_10404457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300012915|Ga0157302_10072683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300012977|Ga0134087_10356871 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012986|Ga0164304_10990933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 665 | Open in IMG/M |
| 3300013100|Ga0157373_10246512 | Not Available | 1263 | Open in IMG/M |
| 3300013307|Ga0157372_12010774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 664 | Open in IMG/M |
| 3300013307|Ga0157372_12169032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 638 | Open in IMG/M |
| 3300013503|Ga0120127_10010675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 1518 | Open in IMG/M |
| 3300014497|Ga0182008_10538775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 647 | Open in IMG/M |
| 3300014875|Ga0180083_1132842 | Not Available | 549 | Open in IMG/M |
| 3300015197|Ga0167638_1062810 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300015372|Ga0132256_100754317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
| 3300015373|Ga0132257_101973973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300015373|Ga0132257_102765630 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300015374|Ga0132255_101680312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300015374|Ga0132255_106261230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 504 | Open in IMG/M |
| 3300016445|Ga0182038_10914677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 774 | Open in IMG/M |
| 3300018482|Ga0066669_10340279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1240 | Open in IMG/M |
| 3300025893|Ga0207682_10461680 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025901|Ga0207688_10451352 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300025903|Ga0207680_10260009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1201 | Open in IMG/M |
| 3300025907|Ga0207645_10243202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300025912|Ga0207707_11106748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300025914|Ga0207671_10375353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1129 | Open in IMG/M |
| 3300025925|Ga0207650_10511995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1004 | Open in IMG/M |
| 3300025925|Ga0207650_11204587 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300025930|Ga0207701_10943545 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300025932|Ga0207690_10567015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300025938|Ga0207704_10724519 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300025938|Ga0207704_11333773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 614 | Open in IMG/M |
| 3300025941|Ga0207711_10207698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 1788 | Open in IMG/M |
| 3300025941|Ga0207711_11643553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 586 | Open in IMG/M |
| 3300025950|Ga0210134_1034645 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300025960|Ga0207651_10633484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 937 | Open in IMG/M |
| 3300025986|Ga0207658_12077614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300026059|Ga0208540_1034418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300026088|Ga0207641_11013121 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300026121|Ga0207683_11598700 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300026342|Ga0209057_1149029 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027818|Ga0209706_10576312 | Not Available | 508 | Open in IMG/M |
| 3300027899|Ga0209668_10871828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 606 | Open in IMG/M |
| 3300028379|Ga0268266_11819790 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300028861|Ga0302259_1128660 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300029984|Ga0311332_11311360 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300029987|Ga0311334_10073425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2475 | Open in IMG/M |
| 3300029990|Ga0311336_10490717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300030000|Ga0311337_11265243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 645 | Open in IMG/M |
| 3300030003|Ga0302172_10261992 | Not Available | 553 | Open in IMG/M |
| 3300030019|Ga0311348_11295532 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300030052|Ga0302217_10109978 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300030339|Ga0311360_10166421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 1812 | Open in IMG/M |
| 3300030838|Ga0311335_11287381 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031232|Ga0302323_101063822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 900 | Open in IMG/M |
| 3300031726|Ga0302321_102142005 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031834|Ga0315290_10946506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300031890|Ga0306925_11120787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031996|Ga0308176_12246949 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032008|Ga0318562_10218719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
| 3300032009|Ga0318563_10024650 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
| 3300032013|Ga0310906_11381825 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032068|Ga0318553_10443704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300032074|Ga0308173_11270371 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300032174|Ga0307470_11088387 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300032205|Ga0307472_100268373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1350 | Open in IMG/M |
| 3300032261|Ga0306920_101111442 | Not Available | 1146 | Open in IMG/M |
| 3300032397|Ga0315287_12819845 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300033412|Ga0310810_10853092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium vitis | 810 | Open in IMG/M |
| 3300033416|Ga0316622_102228610 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300033416|Ga0316622_102872652 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300033482|Ga0316627_100507939 | Not Available | 1072 | Open in IMG/M |
| 3300033488|Ga0316621_10274990 | Not Available | 1094 | Open in IMG/M |
| 3300034354|Ga0364943_0084679 | Not Available | 1091 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 10.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066690_105033222 | 3300005177 | Soil | TIVLIVLSSAASPEFRPKEALISGVLLAALAVGVFVIALKLQLQIWPWTSGILPWSS* |
| Ga0066675_100229561 | 3300005187 | Soil | TASHEFRPKEALISGVLFAALAAGVFVFGLNLQLPLWPWSN* |
| Ga0068996_101615411 | 3300005218 | Natural And Restored Wetlands | LLIVAASAASREFRLRESIVAGCILAAVAVGVFVIGLKLQLPIWPVLR* |
| Ga0065715_108479311 | 3300005293 | Miscanthus Rhizosphere | ASHEFRFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH* |
| Ga0070676_107920192 | 3300005328 | Miscanthus Rhizosphere | WMGVALSTVILIVAARAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR* |
| Ga0068869_1018690502 | 3300005334 | Miscanthus Rhizosphere | ASAGSHEFRPKEAVISGVLLAALAVGVFIVGLSLQLPIWPGQG* |
| Ga0070692_109577542 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | SREFRPKEALIAGVLLATLAVGVFVVGLKLQLPIWPTFFG* |
| Ga0070673_1004671762 | 3300005364 | Switchgrass Rhizosphere | SAASREFRPLESAVSGILLAILCISVFVLALKLQLPIWPSFD* |
| Ga0070710_110583671 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ASHEFRPRESLIVGVVLAALAVGVFVVGLQLQLPIWPGQQ* |
| Ga0070663_1010958192 | 3300005455 | Corn Rhizosphere | ILIVLASAGSHEFRPKEAVISGVLLAALAVGVFIVGLSLQLPIWPGQG* |
| Ga0070663_1013700111 | 3300005455 | Corn Rhizosphere | AVSTVILVVVASAASREFRPREALLSGIVLAALAVGVFVVGLSLQLPIWPGQP* |
| Ga0070707_1008424151 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VASSAASGEFRAKEALISGIVLAALVVGVFVIGLKIQLPIWPGSG* |
| Ga0070679_1008936162 | 3300005530 | Corn Rhizosphere | ALSTVILIVVASAASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQQ* |
| Ga0070686_1007535132 | 3300005544 | Switchgrass Rhizosphere | ILLIVMSSAASSEFRPKEAVISGILLAVLAVGVFVIGLKLQIGIWPGQR* |
| Ga0070693_1005980282 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IVVASAASPEFRPRESLVAGLLLAALAVGVFVVGLQLQLPIWPGQA* |
| Ga0070665_1021091301 | 3300005548 | Switchgrass Rhizosphere | LSTVILIVAASAASREFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPGQQ* |
| Ga0066670_110369472 | 3300005560 | Soil | SAASHEFRPKEALISGILLAALAVGVFVLGLKLVIPIWPGSG* |
| Ga0068854_1012041882 | 3300005578 | Corn Rhizosphere | VILIVAASAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR* |
| Ga0068854_1012483121 | 3300005578 | Corn Rhizosphere | GASAASHEFRFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH* |
| Ga0066706_112975231 | 3300005598 | Soil | TIVLIVLSSAASPEFRPKEAFISAVLLAALAVGVFVIGLKLQLQIWPWTSGILPWSS* |
| Ga0068861_1001520143 | 3300005719 | Switchgrass Rhizosphere | TASAASHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR* |
| Ga0066903_1041063021 | 3300005764 | Tropical Forest Soil | SPEFRPKESVIAGIALAALSVAVFVIALKLQLPIWPQFD* |
| Ga0068870_106816912 | 3300005840 | Miscanthus Rhizosphere | STVILIVAASAASREFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPGQQ* |
| Ga0068862_1001986271 | 3300005844 | Switchgrass Rhizosphere | PRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR* |
| Ga0068862_1014703742 | 3300005844 | Switchgrass Rhizosphere | RFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH* |
| Ga0075284_10588951 | 3300005885 | Rice Paddy Soil | LILIVTSSAASREFRPREALLAGIVLATLAVGVFVVGLQIQLPIWPGQD* |
| Ga0079221_114299271 | 3300006804 | Agricultural Soil | SHEFRPREAVISGVLLAALASLVFIVGLGVQLPIWPLQR* |
| Ga0079219_112689382 | 3300006954 | Agricultural Soil | IVAASAASHEFRPRESLFVGVLLAALAVGVFVVGLQLQLPIWPGQA* |
| Ga0111539_116841052 | 3300009094 | Populus Rhizosphere | VASSAASHEFRPKEAVVAGVLLSALAVGVFVIGLSLQLPIWPVLGR* |
| Ga0111538_103589593 | 3300009156 | Populus Rhizosphere | GAIIVAASAASHEFRPKESVIAGVLLGALAVGVFIIGLKLQLPIWPFQH* |
| Ga0075423_101077461 | 3300009162 | Populus Rhizosphere | HEFRPREAVMSGVLLAALAVGVFIVGLSLQLPIWPDFS* |
| Ga0105248_109637462 | 3300009177 | Switchgrass Rhizosphere | VLSSAASAEFRPREAVVSSVLLAAVVVGVFVFGLHLQLPIWPGAK* |
| Ga0126383_123535371 | 3300010398 | Tropical Forest Soil | FRLKEASISAVLLAALAVGVFVIGLKLQLPVWPWSN* |
| Ga0134122_124676901 | 3300010400 | Terrestrial Soil | PKEALVSGILLAILAVGVFVIGLKLQIGIWPGAR* |
| Ga0134121_104696152 | 3300010401 | Terrestrial Soil | SSAASHEFRPKEALVSGILLAILAVGVFVIGLKLQIGIWPGAR* |
| Ga0137463_11348901 | 3300011444 | Soil | RPKEAVISGILLAMLAVGVFVVGLKLQVPIWPTFLQG* |
| Ga0157333_10363082 | 3300012484 | Soil | ASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQQ* |
| Ga0157301_104044572 | 3300012911 | Soil | AASHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR* |
| Ga0157302_100726831 | 3300012915 | Soil | VASAASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQP* |
| Ga0134087_103568712 | 3300012977 | Grasslands Soil | VGSSAASPEFRPREALIVGVLLAALAVGVFVIGLKLQLPIWPAFVS* |
| Ga0164304_109909332 | 3300012986 | Soil | IVTASAASHEFRPRESLVAGVLLAALAVGVFVVGLQLQLPIWPGQD* |
| Ga0157373_102465122 | 3300013100 | Corn Rhizosphere | FRPRESLVAGLLLSALAVGVFVIGLQLQLPIWPLQP* |
| Ga0157372_120107742 | 3300013307 | Corn Rhizosphere | EFRPRESLVVGVLLAALAVGVFVVGLQLQLPIWPGQA* |
| Ga0157372_121690322 | 3300013307 | Corn Rhizosphere | PRESLVVGVLLAALAVGVFVVGLKLQLPIWPGQA* |
| Ga0120127_100106752 | 3300013503 | Permafrost | VTASAASHEFRPREALIAGVLLAALAVGVFVIGLQLQLPIWPGQA* |
| Ga0182008_105387752 | 3300014497 | Rhizosphere | LSTVILVVVASAASREFRAREALISGIVLAALAVGVFVVGLSLQLPIWPGQP* |
| Ga0180083_11328422 | 3300014875 | Soil | ASAASREFRPKESIVAGLLLAALAVGVFVVGLHLQLPIWPTFI* |
| Ga0167638_10628102 | 3300015197 | Glacier Forefield Soil | ASSTASPEFRPKEALISGILFAALAAGVFIFGLNLQLPLWPWSN* |
| Ga0132256_1007543171 | 3300015372 | Arabidopsis Rhizosphere | PEFRPKESLVSGMALAVLSIAVFVVALKLQLPIWPSFS* |
| Ga0132257_1019739731 | 3300015373 | Arabidopsis Rhizosphere | IVTASAASREFRPRESLLAGLVLAALAVSVFVIGLKLQLPIWPGQD* |
| Ga0132257_1027656302 | 3300015373 | Arabidopsis Rhizosphere | SSAASHEFRPKEAVISGILLSALAVGGFVIGLKLQIGIWPGQR* |
| Ga0132255_1016803122 | 3300015374 | Arabidopsis Rhizosphere | PRESLIVGVLLAALAVGVFVIGLKLQLPIWPAFVS* |
| Ga0132255_1062612301 | 3300015374 | Arabidopsis Rhizosphere | PKESVVSGIALAVLTVTVFVLVLKLQLPIWPQFG* |
| Ga0182038_109146772 | 3300016445 | Soil | FRPLESVVSGIFLAVLSISVFVIALKLQLPIWPSFD |
| Ga0066669_103402791 | 3300018482 | Grasslands Soil | RPREALIAGILLAALAVGVFVIGLKLQLPIWPAFIR |
| Ga0207682_104616801 | 3300025893 | Miscanthus Rhizosphere | NWLGLVFSTMLLIVLSSAASTEFRPKEAVISGVLLAALAVGVFIIGLKLQMGIWPGSR |
| Ga0207688_104513521 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ILIVAASAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR |
| Ga0207680_102600091 | 3300025903 | Switchgrass Rhizosphere | EFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR |
| Ga0207645_102432021 | 3300025907 | Miscanthus Rhizosphere | SAASHEFRPKESVIAGVLLGALAVGVFIIGLKLQLPIWPFQH |
| Ga0207707_111067482 | 3300025912 | Corn Rhizosphere | LKAFWGRPLSTVLLIVMSSAASHEFRPKEAVISGILLAILAVGVFVIGLKLQ |
| Ga0207671_103753531 | 3300025914 | Corn Rhizosphere | HEFRPREAVMSGVLLAALAVGVFIVGLSLQLPIWPDFS |
| Ga0207650_105119952 | 3300025925 | Switchgrass Rhizosphere | ALSTVILIVVASAASSEFRPRESLVAGVLLAALAVGVFVIGLQLQLPIWPLQQ |
| Ga0207650_112045872 | 3300025925 | Switchgrass Rhizosphere | AASHEFRLKESIIAGLLLSALAVGVFVVGLGVQLPIWPAFLRG |
| Ga0207701_109435452 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | STVILIVAASAASREFRPREALIAGVLLATLAVGVFVIGLQLQLPIWPGQR |
| Ga0207690_105670151 | 3300025932 | Corn Rhizosphere | SHEFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPWQR |
| Ga0207704_107245191 | 3300025938 | Miscanthus Rhizosphere | ASHEFRPKEAVISGILLAILAVGVFVIGLKLQIGIWPGGH |
| Ga0207704_113337731 | 3300025938 | Miscanthus Rhizosphere | GASAASHEFRFKESVIAGLLLSGLAVGVFVVGLSVQLPIWPTFLRH |
| Ga0207711_102076983 | 3300025941 | Switchgrass Rhizosphere | TEFRPKEAVISGVLLAALAVGVFIIGLKLQMGIWPGSR |
| Ga0207711_116435532 | 3300025941 | Switchgrass Rhizosphere | VLSSAASAEFRPREAVVSSVLLAAVVVGVFVFGLHLQLPIWPGAK |
| Ga0210134_10346452 | 3300025950 | Natural And Restored Wetlands | RPREAVISGIALAVLVVGVFAIGLKLQIGIWPGTP |
| Ga0207651_106334842 | 3300025960 | Switchgrass Rhizosphere | LSTVILIVTASAASSEFRPRESLAAGVLLAALAVGVFVIGLQLQLPIWPLQQ |
| Ga0207658_120776142 | 3300025986 | Switchgrass Rhizosphere | AARHEFRLKESIISGILLSALAVGVFVIGLSLQLPIWPTFIGG |
| Ga0208540_10344182 | 3300026059 | Natural And Restored Wetlands | VMASAASHEFRPREAVISGIALAVLVVGVFAIGLKLQIGIWPGTP |
| Ga0207641_110131211 | 3300026088 | Switchgrass Rhizosphere | AASHEFRPKEAVISGILLAILAVGVFVIGLKLQIGIWPGGH |
| Ga0207683_115987002 | 3300026121 | Miscanthus Rhizosphere | SAASMEFRPKEALVSGIALAVLSIAVFVIALKLQMPIWPAFD |
| Ga0209057_11490291 | 3300026342 | Soil | PEFRPREALIAGVLLAALAVGVFVIGLKLQLPIWPAFVS |
| Ga0209706_105763121 | 3300027818 | Freshwater Sediment | SASREFRPKEALISGVFLSALAVGVFVIGLKLQLPIWPWTR |
| Ga0209668_108718282 | 3300027899 | Freshwater Lake Sediment | AGLVLSTILLIVMASAASHEYRPREAVISGIALAALAVGVFVIGLKLQIGIWPGAH |
| Ga0268266_118197901 | 3300028379 | Switchgrass Rhizosphere | LSTVILIVAASAASREFRPRESLIAGVLLAALAVGVFVIGLQLQLPIWPGQQ |
| Ga0302259_11286601 | 3300028861 | Fen | FRLRESIIAGVFLAVLAVGVFIIGLHLQLPIWPEFSR |
| Ga0311332_113113602 | 3300029984 | Fen | EFRPKEATIAGVLLAALAVGVFVIGLKLQVPIWPTFLQA |
| Ga0311334_100734253 | 3300029987 | Fen | RPKEAVISGVFLAALAVGVFVVGLKLQLPIWPSFL |
| Ga0311336_104907171 | 3300029990 | Fen | PEFRPKEAVISGVFLAALAVGVFVVGLKLQLPIWPSFL |
| Ga0311337_112652431 | 3300030000 | Fen | ASAASHEFRLRESIIAGVFLAVLAVGVFIIGLHLQLPIWPEFSR |
| Ga0302172_102619922 | 3300030003 | Fen | ASWASPEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG |
| Ga0311348_112955321 | 3300030019 | Fen | ASPEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG |
| Ga0302217_101099782 | 3300030052 | Fen | VLASWASPEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG |
| Ga0311360_101664211 | 3300030339 | Bog | KEALISGVFLAALAVGVFIIGLKLQLPIWPPFLQG |
| Ga0311335_112873812 | 3300030838 | Fen | FRPRESIIAGVFLAVLAVGVFIIGLHLQLPIWPEFSR |
| Ga0302323_1010638222 | 3300031232 | Fen | SEFRWKESLVSGVFLAVLAVSVFVIGLKLQLPIWPTFLHG |
| Ga0302321_1021420051 | 3300031726 | Fen | PEFRLKESLISGVLLAALVVGVFVIGLKLQLPIWPGGLG |
| Ga0315290_109465061 | 3300031834 | Sediment | HEFRPREAVISGIALAALAVGVFVIGLKLQIGIWPGAH |
| Ga0306925_111207871 | 3300031890 | Soil | TVVLIVLASSASPEFRPKESVVSGIALAVLSISVFVIGLKLQLPIWPALG |
| Ga0308176_122469492 | 3300031996 | Soil | KESIVAGLLLSALAVGVFVVGLGVQLPVWPAFLRG |
| Ga0318562_102187192 | 3300032008 | Soil | IVNTVGLVFSTIALIVLASSASPEFRPMESLVSGALLAILAVCVFVIGLKLQIGIWPWSS |
| Ga0318563_100246501 | 3300032009 | Soil | ASSASPEFRPKESVVSGIALAVLSISVFVIGLKLQLPIWPALG |
| Ga0310906_113818251 | 3300032013 | Soil | AASHEFRPKESVIAGVLLGALAVGVFIIGLKLQLPIWPFQH |
| Ga0318553_104437042 | 3300032068 | Soil | IVLASSASPEFRPKESVVSGIALAVLSISVFVIGLKLQLPIWPALG |
| Ga0308173_112703711 | 3300032074 | Soil | SAASHEFRLKESIIAGLLLSALAVGVFVVGLGVQLPIWPTFLRS |
| Ga0307470_110883871 | 3300032174 | Hardwood Forest Soil | VLASAASPEFRPRESLISGIALAVLSISVFVIALKLQLPIWPAFG |
| Ga0307472_1002683731 | 3300032205 | Hardwood Forest Soil | VLASSASPEFRPKESIISGIALAALSVAVFVIALKLQLPIWPQFD |
| Ga0306920_1011114422 | 3300032261 | Soil | IVLASSASPEFRPMESLVSGALLAILAVCVFVIGLKLQIGIWPWSS |
| Ga0315287_128198451 | 3300032397 | Sediment | AASHEYRPREAVISGIALAALAVGVFVIGLKLQIGIWPGAH |
| Ga0310810_108530921 | 3300033412 | Soil | AASAASHEFRPRESLVVGVLLAALAVGVFVVGLQLQLPIWPGQA |
| Ga0316622_1022286102 | 3300033416 | Soil | SREFRPREALVSGALLSALAVGVFVIGLNLQLPIWPGGR |
| Ga0316622_1028726521 | 3300033416 | Soil | ASAASHEFRPKEAVISGLLLAALAVGVFVIGLKLQIGIWPGSR |
| Ga0316627_1005079392 | 3300033482 | Soil | SREFRPREALVSGVLLALLAVGVFVVGLKLQLPVWPVLG |
| Ga0316621_102749902 | 3300033488 | Soil | RPREALVSGVLLALLAVGVFVVGLKLQLPVWPVLG |
| Ga0364943_0084679_973_1089 | 3300034354 | Sediment | FRWKEALISGGLLAVLAVGVFIIGLKLQLPIWPVFLHG |
| ⦗Top⦘ |