| Basic Information | |
|---|---|
| Family ID | F088490 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LIESLQDEVKELSLRTLIQVTKIRKSAGANWKELAEYAICG |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.92 % |
| % of genes from short scaffolds (< 2000 bps) | 0.92 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (21.101 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.477 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.807 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 8.26 |
| PF07460 | NUMOD3 | 1.83 |
| PF08406 | CbbQ_C | 1.83 |
| PF13671 | AAA_33 | 0.92 |
| PF10902 | WYL_2 | 0.92 |
| PF00149 | Metallophos | 0.92 |
| PF01145 | Band_7 | 0.92 |
| PF07728 | AAA_5 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003393|JGI25909J50240_1048990 | Not Available | 882 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 21.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 8.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.59% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 4.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.75% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.83% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.92% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025366 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025420 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM40_10925411 | 3300001839 | Marine Plankton | SLQDKVKELTLRTLIQVTVIRKGLSANWKNLAEYAICG* |
| RCM34_11471311 | 3300001843 | Marine Plankton | FEVSHKKDAMNLIEKLAESVKELSLRTLIQVVKIRKSNPNNRWTKLAEYAICG* |
| RCM41_10058406 | 3300001847 | Marine Plankton | DKVKELTLRTLIQVTVIRKGLSANWKNLAEYAICG* |
| RCM37_10357581 | 3300001850 | Marine Plankton | MPEFSKSLKTDALDLISSLADKVKDLSLRTLIQVTKIRKSSGANWRDLAEYAICG* |
| RCM31_103670941 | 3300001851 | Marine Plankton | KDLSLRTLIQVTKIRKANPNGNWKDLASYAICGG* |
| JGI25908J49247_100530211 | 3300003277 | Freshwater Lake | EFDKTIKADAMSLIERLQDSVKELSLRTLIQVTKIRQGAGKNWANLAEYTICG* |
| JGI25910J50241_100869361 | 3300003388 | Freshwater Lake | MSLIERLQDKVKELSLRTLIQVTKIRESAGKNWSNLAEYTICG* |
| JGI25910J50241_101062691 | 3300003388 | Freshwater Lake | MSLIERLQDKVKELSLRTLIQVTKIRESAGKNWFNLAEYTICG* |
| JGI25909J50240_10489901 | 3300003393 | Freshwater Lake | XSLIERLQDKVKELSLRTLIQVTKIRESAGKNWSNLAEYTICG* |
| JGI25911J50253_101069611 | 3300003411 | Freshwater Lake | KTVKADAMDLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG* |
| Ga0065173_11040582 | 3300004686 | Freshwater | HKVDALNLIDKLRDRVKELSLRTLIQVTKIRKSAGSNWANLAEYSICG* |
| Ga0065170_10228994 | 3300004694 | Freshwater | LIESLQDEVKELSLRTLIQVTKIRKSAGANWKELAEYAICG* |
| Ga0007745_10054344 | 3300004765 | Freshwater Lake | LIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG* |
| Ga0007854_102258061 | 3300004806 | Freshwater | ISTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG* |
| Ga0049081_103079921 | 3300005581 | Freshwater Lentic | KADAMSLIERLQDKVKELSLRTLIQVTKIRESAGKNWSNLAEYTICG* |
| Ga0007881_10140651 | 3300006072 | Freshwater | AMNLIDTLCDKVKDLSLRTLIQVTKIRRNGGDWKNLAEYAICG* |
| Ga0007806_10094709 | 3300006100 | Freshwater | CDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG* |
| Ga0007882_101747743 | 3300006104 | Freshwater | DAMNLIDTLCDKVKDLSLRTLIQVTKIRKNGGDWKDLAEYAIVG* |
| Ga0007882_102272541 | 3300006104 | Freshwater | LCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG* |
| Ga0007862_10514701 | 3300006108 | Freshwater | IDTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG* |
| Ga0007857_10644692 | 3300006112 | Freshwater | NLIDTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG* |
| Ga0007807_10751952 | 3300006116 | Freshwater | LDLIDEVKDSVKELSLRTLIQVLKIRTSVTHDWKSLAEYAICG* |
| Ga0007867_10446111 | 3300006120 | Freshwater | DTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG* |
| Ga0075464_109695011 | 3300006805 | Aqueous | LKDKVKELSLRTLIQVTKIRKGAGTNWKNLAEYATCG* |
| Ga0075464_110970441 | 3300006805 | Aqueous | TKQEKLDALELIDDIQDGVKELSLRTLIQATKIRKSAGAKWKDLAEYTICG* |
| Ga0075459_10454151 | 3300006863 | Aqueous | SFMPDVAKTVKQDALDLIASVVDSVKDLSLRTLIQVTKIRKSAGANWKDLAEYTICG* |
| Ga0075458_100202051 | 3300007363 | Aqueous | FMPDVAKTVKQDALDLIASVVDSVKDLSLRTLIQVTKIRKSAGANWKDLAEYTICG* |
| Ga0102915_12697341 | 3300007562 | Estuarine | LNLIASLADSVKELSLRTLIQVTKIRKANPNNNWKDLAEYAICG* |
| Ga0114340_11625233 | 3300008107 | Freshwater, Plankton | EKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG* |
| Ga0114340_11950423 | 3300008107 | Freshwater, Plankton | QDAVKELSLRTLIQVTKIRQSAGKNWANLAEYTICG* |
| Ga0114880_11089671 | 3300008450 | Freshwater Lake | DNLQDDVKELSLRTLIQTTKIRKSAGAKWKDLAEYTICG* |
| Ga0114963_106482501 | 3300009154 | Freshwater Lake | LKDSIKELSLRTLIQVAKIRKSNPNNNWKNLAEYAICG* |
| Ga0114978_103061014 | 3300009159 | Freshwater Lake | EFMPEYTMQHKTDALNLIDELCDKVKELSLRTLIQVTKIRKSAGSNWKNLAEYAICG* |
| Ga0114978_106954641 | 3300009159 | Freshwater Lake | QKTFMPEYSMTHKVEALLLIQKLADSVKELSLRTLIQVTKIRKSSPSANWKDLAEYTICG |
| Ga0114970_100989451 | 3300009163 | Freshwater Lake | DKAKELTLRTLVQATNIRQNGGANWKDLAEYAICG* |
| Ga0105097_107287843 | 3300009169 | Freshwater Sediment | MVDYSKEEKTDALNLIDDKQNEVKELSLRTLIQTTKIRKSAGAKWKDLAEYTICG* |
| Ga0114959_100256108 | 3300009182 | Freshwater Lake | MDLIEKHQDSVKELSLRTLIQVTKIRQSAGKNWSDLAEYTICG* |
| Ga0114959_101024783 | 3300009182 | Freshwater Lake | SSLVNEVKELSLRSLIQVTKIRAANPNGRWKELATYALCG* |
| Ga0114976_104349743 | 3300009184 | Freshwater Lake | LVSKNDALNLIASLADTVKELSLRTLIQVTKIRKANPNNNWKDLAEYAICG* |
| Ga0114958_106351642 | 3300009684 | Freshwater Lake | KDKEFMPEYSSTLKSDAINLIESVCDDVKELTLRTLIQVVKIRKSAGSNWRNLATYAICG |
| Ga0136644_100518401 | 3300010334 | Freshwater Lake | SIRDEVKELSLRTLIQVVKIRKSNPNNNWKDLATYAIAG* |
| Ga0136644_103307204 | 3300010334 | Freshwater Lake | DLIEKHQDSVKELSLRTLIQVTKIRQSAGKNWSDLAEYTICG* |
| Ga0129333_107691342 | 3300010354 | Freshwater To Marine Saline Gradient | LIESVKDKVKELSLRTLIQVVKIRKGAGPNWKNLAEYTICG* |
| Ga0133913_121736871 | 3300010885 | Freshwater Lake | QDSVKELSLRTLIQVTKIRKANANNNWENLAEYVLTN* |
| Ga0139557_10901703 | 3300011010 | Freshwater | DAMNLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG* |
| Ga0139556_10241291 | 3300011011 | Freshwater | VKADAMDLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG* |
| Ga0151620_10091782 | 3300011268 | Freshwater | MDLIEKHQDTVKELSLRTLIQVTKIRQSAGKNWADLAEYAICG* |
| Ga0119951_10410471 | 3300012000 | Freshwater | TVKADAMNLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG* |
| Ga0157497_10203034 | 3300012664 | Freshwater | DDVKELSLRTLIQVTKIRSSAGSNWKNLAEYTICG* |
| Ga0138284_12073254 | 3300012779 | Freshwater Lake | PDFDLVSKNDALNLIASLADSVKELSLRTLIQVTKIRKANPNNNWKDLAEYAICG* |
| Ga0181343_11294353 | 3300017766 | Freshwater Lake | LIGGLVDKVKELSLRTLIQVTKIRKSAGPRWKDLAEYAIVG |
| Ga0181348_11751591 | 3300017784 | Freshwater Lake | LQDKVKELSLRTLIQVTKIRESAGKNWSNLAEYTICG |
| Ga0211732_11945131 | 3300020141 | Freshwater | EKSDALDMIETLQDEVKELSLRTLIQTTKIRKSAGAKWKDLAEYTICG |
| Ga0211726_1015554313 | 3300020161 | Freshwater | DALDLINSVRDSVKELSLRTLIQVTKIRKSTVSNWKDLAEYTICG |
| Ga0211729_105896183 | 3300020172 | Freshwater | DSVKELSLRTLIQVTKIRKSTVSNWKDLAEYTICG |
| Ga0207941_10224414 | 3300020539 | Freshwater | MPEFDKVVKTDAMNLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG |
| Ga0214246_10636141 | 3300020727 | Freshwater | DLIAELCDNVKELSLRTLIQVTKIRKSAGANWKDLAEYAIVG |
| Ga0214206_10247804 | 3300021131 | Freshwater | LIDSLCDSVKELSLRTLIQVIKVRKSAGSNWKNLAEYAICG |
| Ga0214165_10720651 | 3300021137 | Freshwater | VQDRVKELSLRSLIQCTKIRKSGVANWKDLAEYALCG |
| Ga0214192_11054533 | 3300021142 | Freshwater | DKVKELSLRTLIQVTKIRKSNPNGNWKNLAEYTICG |
| Ga0222713_101700341 | 3300021962 | Estuarine Water | LIENLKDSVKELSLRTLIQVTKIRANAGANWANLAEYTIAG |
| Ga0181351_11572751 | 3300022407 | Freshwater Lake | ERMQYLLDQPGFMADYPKSFKQDALDLINSVRDSVKELSLRTLIQVTKIRKSSVTNWKDLAEYTICG |
| Ga0244775_110556774 | 3300024346 | Estuarine | PKSHKQDALDLINSVRDSVKELSLRTLIQVTKIRKSTVSNWKDLAEYTICG |
| Ga0244776_108776693 | 3300024348 | Estuarine | DSVKELSLRTLIQVTKIRKANPNNNWKDLAEYAICG |
| Ga0255169_10170516 | 3300024356 | Freshwater | EANNQHKVDAIGLIEKLQDTVKELSLRTLIQVTKIRANAGANWANLAEYAICG |
| Ga0208504_10108211 | 3300025358 | Freshwater | STLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0208505_10233861 | 3300025366 | Freshwater | MDLISDLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0208250_10194591 | 3300025383 | Freshwater | IDTVCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0207959_10584041 | 3300025387 | Freshwater | PEYDKQVKQDAMNLIDNVKDKVKELSLRTLIQVTKIRKSGGANWANLAEYTICG |
| Ga0208257_10589443 | 3300025389 | Freshwater | NVKDKVKELSLRTLIQVTKIRKSGGANWANLAEYTICG |
| Ga0208387_10304533 | 3300025400 | Freshwater | VDALNLIDKLRDRVKELSLRTLIQVTKIRKSAGANWANLAEYSICG |
| Ga0208378_10780122 | 3300025407 | Freshwater | MNLIDTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0208614_10361683 | 3300025413 | Freshwater | CDKVKDLSLRTLIQVTKIRRNGGDWKNLAEYAICG |
| Ga0208111_10209001 | 3300025420 | Freshwater | MGLIEKVANKVKELSLRTLIQVVKIRNSNPNGRWAKLAEYAICG |
| Ga0208617_10541361 | 3300025424 | Freshwater | SKLVDSVKELSLRTLIQVTKIRKSNPNGKWKDLATYAICG |
| Ga0208147_10133331 | 3300025635 | Aqueous | FMPDVAKTVKQDALDLIASVVDSVKDLSLRTLIQVTKIRKSAGANWKDLAEYTICG |
| Ga0208498_10457762 | 3300025785 | Freshwater | LDLIDEVKDSVKELSLRTLIQVLKIRTSVTHDWKSLAEYAICG |
| Ga0208872_11655361 | 3300025838 | Freshwater | MDLISTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0255166_10911921 | 3300026473 | Freshwater | ADAMSLIERLQDQVKELSLRTLIQVTKIRQSAGKNWANLAEYTICG |
| Ga0255106_10392631 | 3300027125 | Freshwater | FDKVIKTDAMNLIEKHQDTVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG |
| Ga0209188_10402341 | 3300027708 | Freshwater Lake | DLIDKLKDSIKELSLRTLIQVAKIRKSNPNNNWKNLAEYAICG |
| Ga0209085_13301451 | 3300027741 | Freshwater Lake | LKDSIKELSLRTLIQVAKIRKSNPNNNWKNLAEYAICG |
| Ga0209355_11860984 | 3300027744 | Freshwater Lake | EFDKVVKTDAMNLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG |
| Ga0209084_11852513 | 3300027749 | Freshwater Lake | KNDAMSLIDKLQDKVKELSLRTLIQVTKIRKSAGSNWSNLAEYTICG |
| Ga0209768_104119873 | 3300027772 | Freshwater Lake | PEFSKPIKEEAMALIERLQDKVKELSLRTLIQVTKIRQSAGKNWANLAEYTICG |
| Ga0209777_111430971 | 3300027896 | Freshwater Lake Sediment | VDEVKELSLRTLIQVTKIRKANPNGNWKNLAEYAICG |
| Ga0304729_11500701 | 3300028392 | Freshwater Lake | ESVCDDVKELTLRSLIQVVKIRKSAGSNWRNLATYAICG |
| Ga0304728_12057501 | 3300028393 | Freshwater Lake | KVKELSLRTLMQVIKIRKANPNGKWKDLAEYAICG |
| Ga0315909_101789511 | 3300031857 | Freshwater | DSVKELSLRTLIQVTKIRKSAGSNWRNLAEYTICG |
| Ga0315909_102864495 | 3300031857 | Freshwater | MNLIDSLKDSVKELSLRTLIQVTKIRKSAGSNWRNLAEYTICG |
| Ga0315905_109604794 | 3300032092 | Freshwater | LIERLQDSVKELSLRTLIQVTKIRQSAGKNWANLAEYTICG |
| Ga0315903_107575091 | 3300032116 | Freshwater | LIDDVKDRVRELSLRSLIQCTKIRKANPNGNWKQLAEFALCG |
| Ga0316226_13357723 | 3300032562 | Freshwater | DALDLIAGVVDEVKELSLRTLIQVTKIRKSNPNGNWKNLAEYAICG |
| Ga0316221_100464926 | 3300032665 | Freshwater | DALNLIDKLRDRVKELSLRTLIQVTKIRKSAGSNWANLAEYSICG |
| Ga0316229_11387134 | 3300032676 | Freshwater | DTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0316229_12830621 | 3300032676 | Freshwater | FMPEFDMAQKIDALNLIDKLRDRVKELSLRTLIQVTKIRKSAGSNWANLAEYSICG |
| Ga0316227_11077981 | 3300032677 | Freshwater | NLIDKVADKVKELSLRTLIQVTKIRKSNPNGNWKNLAEYTICG |
| Ga0316231_11348934 | 3300032722 | Freshwater | VCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0316224_10573988 | 3300032753 | Freshwater | DAMNLIDTLCDKVKDLSLRTLIQVTKIRKNGGDWKNLAEYAICG |
| Ga0334982_0350914_494_664 | 3300033981 | Freshwater | MPEYPRAMKLDALNLIDSLRDNVKEMSLRTLIQVTKIRKANPNGKWKSLAEYTICG |
| Ga0334979_0024529_3_149 | 3300033996 | Freshwater | EKQDAMDLIESVKDTVKELSLRTLIQVTKIRKSAGKNWKDLAEYTVCG |
| Ga0334985_0612019_489_605 | 3300034018 | Freshwater | NLQDEVKELSLRTLIQTTKIRKSAGAKWKDLAEYTICG |
| Ga0334995_0193281_1225_1422 | 3300034062 | Freshwater | MQYLLDQPGFMADYPKSFKQDALDLINSVRDSVKELSLRTLIQVTKIRKSSVTNWKDLAEYTICG |
| Ga0335000_0334492_14_181 | 3300034063 | Freshwater | MADYPKSFKQDALDLINSVRDSVKELSLRTLIQVTKIRKSSVTNWKDLAEYTICG |
| Ga0335012_0005845_7288_7455 | 3300034093 | Freshwater | MPEFDKTIKADAMGLIERLQDSVKELSLRTLIQVTKIRQGAGKNWANLAEYTICG |
| Ga0335030_0156713_1_153 | 3300034103 | Freshwater | KSFKQDALDLINSVRDSVKELSLRTLIQVTKIRKSSVTNWKDLAEYTICG |
| Ga0335035_0552672_3_131 | 3300034105 | Freshwater | DLIDNLQDEVKELSLRTLIQTTKIRKSAGAKWKDLAEYTICG |
| Ga0335049_0669729_3_131 | 3300034272 | Freshwater | NLIEKHQDSVKELSLRTLIQVTKIRQGAGKNWSDLAEYAICG |
| Ga0335007_0080152_1_141 | 3300034283 | Freshwater | DALNLIDDVKDRVRELSLRSLIQCTKIRKSNPNGNWKQLAEFALCG |
| ⦗Top⦘ |