| Basic Information | |
|---|---|
| Family ID | F088483 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNAAAIIIIAIAATGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPG |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.63 % |
| % of genes near scaffold ends (potentially truncated) | 82.57 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.413 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.183 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.046 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 19.27 |
| PF04237 | YjbR | 6.42 |
| PF13520 | AA_permease_2 | 5.50 |
| PF02633 | Creatininase | 1.83 |
| PF00561 | Abhydrolase_1 | 0.92 |
| PF13365 | Trypsin_2 | 0.92 |
| PF12867 | DinB_2 | 0.92 |
| PF07883 | Cupin_2 | 0.92 |
| PF09865 | DUF2092 | 0.92 |
| PF07676 | PD40 | 0.92 |
| PF13304 | AAA_21 | 0.92 |
| PF13414 | TPR_11 | 0.92 |
| PF02683 | DsbD | 0.92 |
| PF08327 | AHSA1 | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF09278 | MerR-DNA-bind | 0.92 |
| PF08281 | Sigma70_r4_2 | 0.92 |
| PF11746 | DUF3303 | 0.92 |
| PF01925 | TauE | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 19.27 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 6.42 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 1.83 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.41 % |
| Unclassified | root | N/A | 4.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10101491 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300000955|JGI1027J12803_108639821 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10151942 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005174|Ga0066680_10775906 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005181|Ga0066678_10669304 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005344|Ga0070661_100226253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300005436|Ga0070713_101629155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 626 | Open in IMG/M |
| 3300005450|Ga0066682_10422286 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005458|Ga0070681_10163519 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300005468|Ga0070707_101090611 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005532|Ga0070739_10192619 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005555|Ga0066692_10975342 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005556|Ga0066707_10283043 | Not Available | 1085 | Open in IMG/M |
| 3300005566|Ga0066693_10151444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300005568|Ga0066703_10016348 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
| 3300005602|Ga0070762_10207665 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005952|Ga0080026_10030644 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300005995|Ga0066790_10225038 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006028|Ga0070717_11090783 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006806|Ga0079220_11217448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300006893|Ga0073928_10197334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1579 | Open in IMG/M |
| 3300006903|Ga0075426_10639866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300007076|Ga0075435_100736805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300009545|Ga0105237_12342137 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009624|Ga0116105_1139841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 635 | Open in IMG/M |
| 3300010043|Ga0126380_12290564 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010047|Ga0126382_11800904 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010048|Ga0126373_11478291 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010048|Ga0126373_12556331 | Not Available | 569 | Open in IMG/M |
| 3300010361|Ga0126378_10767768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300010366|Ga0126379_12658763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300010376|Ga0126381_101818641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300010399|Ga0134127_10829278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300011120|Ga0150983_14026549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300012285|Ga0137370_10182356 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300012354|Ga0137366_10179083 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1590 | Open in IMG/M |
| 3300012354|Ga0137366_11187951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 520 | Open in IMG/M |
| 3300012359|Ga0137385_10494426 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300013105|Ga0157369_12694021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300016341|Ga0182035_11608421 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300016404|Ga0182037_11086548 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300017823|Ga0187818_10283757 | Not Available | 726 | Open in IMG/M |
| 3300017940|Ga0187853_10406650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 602 | Open in IMG/M |
| 3300017943|Ga0187819_10789727 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017946|Ga0187879_10629324 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300017955|Ga0187817_10176925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1358 | Open in IMG/M |
| 3300017955|Ga0187817_10937171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300017970|Ga0187783_11189603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300017972|Ga0187781_10474232 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300017975|Ga0187782_11319111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 566 | Open in IMG/M |
| 3300017995|Ga0187816_10394732 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300018024|Ga0187881_10369507 | Not Available | 589 | Open in IMG/M |
| 3300018025|Ga0187885_10076803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis | 1656 | Open in IMG/M |
| 3300018025|Ga0187885_10192426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 948 | Open in IMG/M |
| 3300018037|Ga0187883_10282003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 849 | Open in IMG/M |
| 3300018057|Ga0187858_10425777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 821 | Open in IMG/M |
| 3300018086|Ga0187769_10618223 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300018431|Ga0066655_11112096 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018468|Ga0066662_12418608 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018482|Ga0066669_11968802 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300020579|Ga0210407_10978647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300020581|Ga0210399_10773537 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300020583|Ga0210401_10029684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5209 | Open in IMG/M |
| 3300020583|Ga0210401_10271971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1554 | Open in IMG/M |
| 3300021088|Ga0210404_10606797 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300021170|Ga0210400_10016878 | All Organisms → cellular organisms → Bacteria | 5742 | Open in IMG/M |
| 3300021170|Ga0210400_11438556 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021171|Ga0210405_10668783 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021178|Ga0210408_11320127 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021181|Ga0210388_10428524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300021403|Ga0210397_10060742 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300021405|Ga0210387_10427273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300021406|Ga0210386_10901748 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021407|Ga0210383_10243542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
| 3300021420|Ga0210394_10364463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300021433|Ga0210391_10368490 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300021433|Ga0210391_10499142 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300021474|Ga0210390_10561673 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021475|Ga0210392_10135999 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300025480|Ga0208688_1057994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300025920|Ga0207649_10080983 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300025921|Ga0207652_10606439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300025923|Ga0207681_11870531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 500 | Open in IMG/M |
| 3300025927|Ga0207687_10178324 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300025928|Ga0207700_10062942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2819 | Open in IMG/M |
| 3300025981|Ga0207640_10140530 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300026118|Ga0207675_101561724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300026217|Ga0209871_1064605 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300026312|Ga0209153_1266788 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027073|Ga0208366_1005185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1287 | Open in IMG/M |
| 3300027172|Ga0208098_1021391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300027889|Ga0209380_10517661 | Not Available | 695 | Open in IMG/M |
| 3300028047|Ga0209526_10522775 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300028759|Ga0302224_10304458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300029903|Ga0247271_110339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1372 | Open in IMG/M |
| 3300029910|Ga0311369_10653019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300030042|Ga0302300_1205482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300030991|Ga0073994_10025810 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300031525|Ga0302326_12159166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300031720|Ga0307469_10611697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300031740|Ga0307468_101475006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300031754|Ga0307475_10826947 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031941|Ga0310912_10495234 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300032035|Ga0310911_10897841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300032180|Ga0307471_101585600 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300032180|Ga0307471_103815649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300032205|Ga0307472_101259750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300032895|Ga0335074_10087441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4149 | Open in IMG/M |
| 3300033829|Ga0334854_003106 | All Organisms → cellular organisms → Bacteria | 4060 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101014913 | 3300000567 | Peatlands Soil | MTAAAIIIIAIAALGVLMMRFRKRWLARINIAFTNRITSLFAGWLPGFGILTHL |
| JGI1027J12803_1086398212 | 3300000955 | Soil | MSIGAIIVIAIAASGVLMMRFRKRWLAKINIIFTNRITSLFA |
| JGIcombinedJ51221_101519421 | 3300003505 | Forest Soil | VNAAAIIIVAIAATGVLMVRFRKRWLAKINIAVTNRITSLFAGWLPGFGILTHV |
| Ga0066680_107759062 | 3300005174 | Soil | VSVGAIIAIAISAAAILLMRFRKRWLAKFNIAVTNRITGLFAGWLPGFG |
| Ga0066678_106693041 | 3300005181 | Soil | VSVGAIIAIAIPAAAILLMRFRKRWLAKFNIAVTNRITGLFAGWL |
| Ga0070661_1002262531 | 3300005344 | Corn Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLA |
| Ga0070713_1016291552 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIGAIIIIVIAASGVLMMRFRKRWLAKINIVLTNRITGLFAGWL* |
| Ga0066682_104222861 | 3300005450 | Soil | VSVGAIIAIAIPAAALLPMRFRKRWLAKFNIAVTKRITGLFAGWLPGFGIL |
| Ga0070681_101635193 | 3300005458 | Corn Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAGWIPGFGILTHVGRKS |
| Ga0070707_1010906112 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAGAIIIVAIATTGVLLMRFRKRWLARINIAVTNRITGLFAGWLPGFGILT |
| Ga0070739_101926193 | 3300005532 | Surface Soil | VSILSILAIAIPVSGILMMRFRKRWLAKFNILVTN |
| Ga0066692_109753422 | 3300005555 | Soil | VSVGAIIAIAIPATAILLMRFRKRWLAKFNIAVTN |
| Ga0066707_102830431 | 3300005556 | Soil | MLLVLIVAIAVTGVLLMRFRKRWLARINIAVTNRITGLFAGWL |
| Ga0066693_101514441 | 3300005566 | Soil | MRVGLILAIAIPATGVLMMRFRKRWLAKFNITVTTESRPC |
| Ga0066703_100163481 | 3300005568 | Soil | MIAGAIIVIVIAASGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPGFGI |
| Ga0070762_102076653 | 3300005602 | Soil | MNAAAIEIIAIAATGMLMMRFHMRWVAKINIAFTSLFTGWLPGFGILTTSDESRGKSTGLR* |
| Ga0080026_100306443 | 3300005952 | Permafrost Soil | MSTGAILAIAVLATAILMMRFRKRWLATINIAVTNRITSLFAG* |
| Ga0066790_102250381 | 3300005995 | Soil | MSAGAIIVIALAASGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPGFGILTHVGR |
| Ga0070717_110907833 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTGAIIIIVIAASGVLMMRFRKRWLARINIAFTNRITSLFAGWLPAFGILSHVG |
| Ga0079220_112174481 | 3300006806 | Agricultural Soil | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAGWIPGF |
| Ga0073928_101973341 | 3300006893 | Iron-Sulfur Acid Spring | MNAAAIIIIAIAATGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPG |
| Ga0075426_106398662 | 3300006903 | Populus Rhizosphere | MSAGAIITIAIAATGILLMRFRKRWLAKFNIVVTNRITGLFAGYVPG |
| Ga0075435_1007368052 | 3300007076 | Populus Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAGW |
| Ga0105237_123421372 | 3300009545 | Corn Rhizosphere | MPITIIILVVIPLSGMLMMRFRKKSLARFNLAVTNRITGLFAGWLPLFGIITHVG |
| Ga0116105_11398411 | 3300009624 | Peatland | VNAAAIIIVAIAATGVLMMRFRKRWLAKMDIVLTNRITGLFEGWLPGFGI |
| Ga0126380_122905641 | 3300010043 | Tropical Forest Soil | VSIGLILAAAIPAAAILMMRFRKRWLARFNIAVTNRITGLFAGWLPGFGILTH |
| Ga0126382_118009043 | 3300010047 | Tropical Forest Soil | VSTGAIVIVAIAATGMLLMRFRKRWLAKINIAVTNRITSLFAGWLPGFGILTHV |
| Ga0126373_114782913 | 3300010048 | Tropical Forest Soil | MSAAAILIVAIAVSRILMMRFRERWLAKINIAFTNRITNLFAG* |
| Ga0126373_125563312 | 3300010048 | Tropical Forest Soil | MSAGAIIIIVIAAAGVLMMRLRKRWLAKINIILTNRITGLF |
| Ga0126378_107677682 | 3300010361 | Tropical Forest Soil | VSTGAILVTVIAASGVLMMRFRKRWLAKINIAFTNRITSLFAGWLRE* |
| Ga0126379_126587632 | 3300010366 | Tropical Forest Soil | MTAGAIIIIAIAASGVLMMRFRKRWLAKINSAFINRITSLFAGWLPGFGILTHVG |
| Ga0126381_1018186411 | 3300010376 | Tropical Forest Soil | VSITALLVIVVATTGMLLMRFRKRWLAKINIAFTNRITSLFAGWLPG |
| Ga0134127_108292782 | 3300010399 | Terrestrial Soil | MSIAIIILVVAIPLSGMLLMRFRKRWLAKINLAITNRITSRFAGWLPLFGIVTHV |
| Ga0150983_140265492 | 3300011120 | Forest Soil | MSAVVILIIAIAASGVLLMRFRKRWLAKINIAFTNRITSLFAGWLPGFGILNHVG |
| Ga0137370_101823564 | 3300012285 | Vadose Zone Soil | VSVGAIIAIAIPAAAILLMRFRKRWLAKFNIAVTNRITGLFAGWLTGFGISLTWAANL |
| Ga0137366_101790834 | 3300012354 | Vadose Zone Soil | MSVVAILAIAIPATGTLMMRFRKRWLAKINIAFTNRITGLFAGWLPGFGILTHIGRKS |
| Ga0137366_111879511 | 3300012354 | Vadose Zone Soil | MSTGLILAIAIPTTLILMMRFRKRWLAKFNIAVTNRFTGLFAG* |
| Ga0137385_104944263 | 3300012359 | Vadose Zone Soil | MIAGAIIIIVIAASGVLMMRFRKRWLAKINIVLTNR |
| Ga0157369_126940211 | 3300013105 | Corn Rhizosphere | MSAGAIITIAIAATGILLMRFRKRWLAKFNIVVTNRITGLFAGYVPGFG |
| Ga0182035_116084212 | 3300016341 | Soil | MSAGAILVSAIAATEILLMRFRKRRLAKINIAFTNRITSLFAGWLPE |
| Ga0182037_110865482 | 3300016404 | Soil | VSAGAILVIVIAASGVLMMRFRKRWLAKINIAFTNRITSLFAGWLPE |
| Ga0187818_102837572 | 3300017823 | Freshwater Sediment | MYAAAIVIIVIAASGVLMMRFQKRWLAKINIVLTNRIT |
| Ga0187853_104066502 | 3300017940 | Peatland | VNTAAIIIVAIAAMGVLMMRFRKRWLAKINLAFTNRI |
| Ga0187819_107897271 | 3300017943 | Freshwater Sediment | VSAGVIIIIVIAASGILMMRFRKRWLAKINIVFTNRITGLFAGW |
| Ga0187879_106293241 | 3300017946 | Peatland | VVIAIVIIAIAATGVLMMRFRKRWLAKINIAFTNRITSLFA |
| Ga0187817_101769251 | 3300017955 | Freshwater Sediment | VNAAAIIIIVIAASGVLMMRFRKRWLAKINIALTNRITS |
| Ga0187817_109371711 | 3300017955 | Freshwater Sediment | VSAVAVIAIIVAIAASGVLMMRFRKRWLARINIAFTNRIT |
| Ga0187783_111896032 | 3300017970 | Tropical Peatland | MSAGAIIIIAIAASSVLMLRFQKRWLAKINIVLTNGITGVFAGWLLGFGILGTPH |
| Ga0187781_104742323 | 3300017972 | Tropical Peatland | MSAGAIIIAAIATTGVLLMRFRKRWLAKINIVFTNRITSLFAGWLPGFGILTHVGR |
| Ga0187782_113191112 | 3300017975 | Tropical Peatland | MIVAIAATGVLLMRFRKRWLAKKLAKINIVFTNRITRLFAGWLPGFG |
| Ga0187816_103947321 | 3300017995 | Freshwater Sediment | MSTGAVLAIAILATGILMMRFRKRWLAKFNIAVTNRITSLF |
| Ga0187881_103695071 | 3300018024 | Peatland | MNAAAIIIIAIAATGVLMMRFRKRWLAKINIILTNRITSLFAGW |
| Ga0187885_100768031 | 3300018025 | Peatland | MKALAIIIIAIAVSGVLLMRFRKRWLAKINIVFTNR |
| Ga0187885_101924261 | 3300018025 | Peatland | MSVGAILVIAIAVSGILLMRFRKRWLAKINIVFTNR |
| Ga0187883_102820032 | 3300018037 | Peatland | VNTAAIIIVAIAAMGVLMMRFRKRWLAKINLAFTNR |
| Ga0187858_104257771 | 3300018057 | Peatland | VNAAAIIIVAIAATGVLMMRFRKRWLAKMDIVLTNRITGLFEGW |
| Ga0187769_106182233 | 3300018086 | Tropical Peatland | VNAAAIIIVAIAASGILMMRFRKRWLAKINIVFTNRITSLFAGWLPGFGIL |
| Ga0066655_111120962 | 3300018431 | Grasslands Soil | VSTGLILAIAIATTGVLMMRFRKRWLAKFNIFITNRITALFAGWLPGFGIL |
| Ga0066662_124186082 | 3300018468 | Grasslands Soil | MSAGAIIIVTIAATGVLMMRFRKRWLAKINIAFTH |
| Ga0066669_119688022 | 3300018482 | Grasslands Soil | VSVGAIIAIAISAAAILLMRFRKRWLAKFNIAVTNRITGLFAGWL |
| Ga0210407_109786471 | 3300020579 | Soil | MSAGAIIIIAISVTGILMMRFRKRWLAKFNIAVTNRITSLFAG |
| Ga0210399_107735373 | 3300020581 | Soil | VNAAAIIIIALAATGVLLMRFRKRWLAKINIAFTNRITGLFAGWLPGS |
| Ga0210401_100296841 | 3300020583 | Soil | MNAAAIVIIAIAATGVLMMRFRKRWLAKINIALTNRITGLFAGW |
| Ga0210401_102719711 | 3300020583 | Soil | MSAGAIIIIAIAVTGILMMRFRKRGLAKFNIAVTNRITSLFAGWL |
| Ga0210404_106067971 | 3300021088 | Soil | VNAAAIIIIALAATGVLLMRFRKRWLAKINIAFTNRIAGLFAGWLPGF |
| Ga0210400_100168789 | 3300021170 | Soil | MSAGAIIIIAISVTGILMMRFRKRWLAKFNIAVTNRITTLFA |
| Ga0210400_114385561 | 3300021170 | Soil | MSTGAILAIAILSTGILMMRFRKRWLANFNIAVTNRITSLFAGWLSGHWHS |
| Ga0210405_106687831 | 3300021171 | Soil | MNAAAITIIAIAATGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPGF |
| Ga0210408_113201272 | 3300021178 | Soil | VSVGAIIVIAIAATGILLMRFRKRWLAKINIAFTNRITSLFAGWLPG |
| Ga0210388_104285242 | 3300021181 | Soil | MNAAAIEIIAIAATGMLMMRFHMRWLAKINIAFTSLFTGWLPGFGILTTSDESRGKSTGL |
| Ga0210397_100607426 | 3300021403 | Soil | MTAAAIIIIAIAASGVLMMRFRKRWLARINIAFTNRITSLFAGWLPAFGILSHV |
| Ga0210387_104272732 | 3300021405 | Soil | MSAGAIIVIAVAASGVLMMRFRKRSLAKINIIFTNRITSLFAGWLLGFGILTHIGRKSG |
| Ga0210386_109017483 | 3300021406 | Soil | MNAAAITIIAIAATGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPGFGIL |
| Ga0210383_102435423 | 3300021407 | Soil | MNAAAIVIIAIAATGVLMMRFRKRWLAKINIAFTNRITG |
| Ga0210394_103644634 | 3300021420 | Soil | MNAAAIIIIAIAATGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPGFG |
| Ga0210391_103684902 | 3300021433 | Soil | MNAAAIEIIAIAATGMLMMRFHMRWVAKINIAFTSLFTGWLPGFGILTTSDESRGKSTGL |
| Ga0210391_104991422 | 3300021433 | Soil | MSTGAILAIAILSTGILMMRFRKRWLANFNIAVTNRITS |
| Ga0210390_105616731 | 3300021474 | Soil | VSVGAIIVIAIAATGILLMRFRKRWLAKINIAFTNR |
| Ga0210392_101359994 | 3300021475 | Soil | MSTGAILAIAILSTGILMMRFRKRWLANFNIAVTNRITSLFAGWLSELWHSH |
| Ga0208688_10579941 | 3300025480 | Peatland | MNAGAIIIIAIAATGVLMMRFRKRWLAKINMAFTNRITSLFA |
| Ga0207649_100809831 | 3300025920 | Corn Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAAGFRVSAFS |
| Ga0207652_106064391 | 3300025921 | Corn Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAG |
| Ga0207681_118705312 | 3300025923 | Switchgrass Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTN |
| Ga0207687_101783241 | 3300025927 | Miscanthus Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAGWI |
| Ga0207700_100629424 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIGAIIIIVIAASGVLMMRFRKRWLAKINIVLTNRITGLFAGWL |
| Ga0207640_101405301 | 3300025981 | Corn Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAAGFRV |
| Ga0207675_1015617241 | 3300026118 | Switchgrass Rhizosphere | MRAGAIFLIAVAATGMLMMRFRKRWLAKINIAFTNRFTGRLAGWIPGFGIL |
| Ga0209871_10646052 | 3300026217 | Permafrost Soil | MSTGAILAIAVLATAILMMRFRKRWLATINIAVTNRITSLFAG |
| Ga0209153_12667881 | 3300026312 | Soil | MSAGAIIAVAIAATGILLMRFRKRWLAKINIAFTNRITRLFAGWLPGFGILTHV |
| Ga0208366_10051853 | 3300027073 | Forest Soil | LSAGAIIIIAIAASGVLLMRFRKRWLAKINIAFTNRIAGLFAGSLPGFGILNHVGRK |
| Ga0208098_10213911 | 3300027172 | Forest Soil | MSAVVILIIAIAASGVLLMRFRKRWLAKINIAFTNRIAGLFAGSLPGFGILN |
| Ga0209380_105176611 | 3300027889 | Soil | MVIAIVVAIAATGILMMRFRKRWLAKINIVFTNRITSLFAGWL |
| Ga0209526_105227753 | 3300028047 | Forest Soil | MIAATIIIIAIAATGVLLMRFRKRWLAKINIAFTNRITSLFA |
| Ga0302224_103044582 | 3300028759 | Palsa | MSLGVVIITLIAATGVLMMRFQKRWLAKINIAFTNRITSLFAGWLPGFG |
| Ga0247271_1103392 | 3300029903 | Soil | VVIAIVIIAIAATGVLMMRFRKRWLAKINIAFTNRITGLFAGWLPDFGILXXXXLT |
| Ga0311369_106530191 | 3300029910 | Palsa | MSLGVVIITLIAATGVLMMRFQKRWLAKINIAFTNRIT |
| Ga0302300_12054821 | 3300030042 | Palsa | MSLGVVIITLIAATGVLMMRFQKRWLAKINIAFTNRITSLFAG |
| Ga0073994_100258106 | 3300030991 | Soil | MIAGAIIIIAIAATGMLMMRFRKRWLAKINVAFTNRITGLFAGWLPGFGILRM |
| Ga0302326_121591661 | 3300031525 | Palsa | MSLGVVIITLIAATGVLMMRFQKRWLAKINIAFTNRITS |
| Ga0307469_106116973 | 3300031720 | Hardwood Forest Soil | MSAGAVIAVIVAIAASGVLMMRFRKRWLAKINIAFTN |
| Ga0307468_1014750062 | 3300031740 | Hardwood Forest Soil | MSAGAIIVIAVAATGILMMRFRKRWLAKFNIAVTNRITSLFAG |
| Ga0307475_108269471 | 3300031754 | Hardwood Forest Soil | MSTGSILAIAILATAILMMRFRKRWVAKFNIAVTNRITSLFAG |
| Ga0310912_104952342 | 3300031941 | Soil | MIREHRSHLVTVIAASGVLMMRFRKRWLAKINIAFTNRITSLFAGWLPE |
| Ga0310911_108978412 | 3300032035 | Soil | MNPAAIIIIAIAASGVLMMRFRKRWLAKINIAFTNRITSLFAGWLPGFGIL |
| Ga0307471_1015856001 | 3300032180 | Hardwood Forest Soil | MSTGAILAIAILATGILMMRFRKRWLAKINIAFTNRITS |
| Ga0307471_1038156492 | 3300032180 | Hardwood Forest Soil | MRAGAIIIIAIAASGVLMMRFRKRWLAKINIAVTNRITNLFAGWLP |
| Ga0307472_1012597501 | 3300032205 | Hardwood Forest Soil | MTAAAIIIIAIAASGVLMMLFRKRWMAKINIAFTNQITGLFAGW |
| Ga0335074_100874415 | 3300032895 | Soil | MSPGAVIAIVIAIAASGVSMMRFRKRWLAKINIAVTNRITGLFA |
| Ga0334854_003106_774_932 | 3300033829 | Soil | MNAAAIIIIAIAATGVLMTRFRRRWLAKINIAFTNRITSRFAARLPGFGILT |
| ⦗Top⦘ |