| Basic Information | |
|---|---|
| Family ID | F088443 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDRIGS |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.23 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 85.32 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.872 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.294 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF04029 | 2-ph_phosp | 79.82 |
| PF02786 | CPSase_L_D2 | 8.26 |
| PF02785 | Biotin_carb_C | 7.34 |
| PF00364 | Biotin_lipoyl | 1.83 |
| PF01321 | Creatinase_N | 0.92 |
| PF01220 | DHquinase_II | 0.92 |
| PF02472 | ExbD | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 159.63 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.92 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.92 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1002374 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 2502 | Open in IMG/M |
| 3300001661|JGI12053J15887_10250170 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300002558|JGI25385J37094_10040351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1609 | Open in IMG/M |
| 3300002911|JGI25390J43892_10082537 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300002911|JGI25390J43892_10087421 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300002911|JGI25390J43892_10142595 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300002912|JGI25386J43895_10118353 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005167|Ga0066672_10704373 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005177|Ga0066690_10288497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1107 | Open in IMG/M |
| 3300005178|Ga0066688_10048135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2454 | Open in IMG/M |
| 3300005179|Ga0066684_10060571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2206 | Open in IMG/M |
| 3300005187|Ga0066675_10069749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2231 | Open in IMG/M |
| 3300005445|Ga0070708_100478910 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1174 | Open in IMG/M |
| 3300005546|Ga0070696_100208048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1463 | Open in IMG/M |
| 3300005546|Ga0070696_101209622 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005556|Ga0066707_10386299 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005556|Ga0066707_10873162 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005557|Ga0066704_10390940 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005587|Ga0066654_10239167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 955 | Open in IMG/M |
| 3300006031|Ga0066651_10117098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1363 | Open in IMG/M |
| 3300006845|Ga0075421_101401524 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300007076|Ga0075435_100707861 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300009088|Ga0099830_10891025 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009089|Ga0099828_10226366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1672 | Open in IMG/M |
| 3300009808|Ga0105071_1088097 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010303|Ga0134082_10133283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 998 | Open in IMG/M |
| 3300010320|Ga0134109_10186828 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010321|Ga0134067_10472519 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010322|Ga0134084_10393123 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010325|Ga0134064_10474734 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010335|Ga0134063_10132747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1146 | Open in IMG/M |
| 3300010336|Ga0134071_10074868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1576 | Open in IMG/M |
| 3300010336|Ga0134071_10323429 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010337|Ga0134062_10281144 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010400|Ga0134122_10301627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1375 | Open in IMG/M |
| 3300011269|Ga0137392_11204834 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300011434|Ga0137464_1021428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1728 | Open in IMG/M |
| 3300012034|Ga0137453_1036820 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012189|Ga0137388_10563972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1058 | Open in IMG/M |
| 3300012198|Ga0137364_10021678 | All Organisms → cellular organisms → Bacteria | 3963 | Open in IMG/M |
| 3300012349|Ga0137387_10194421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1456 | Open in IMG/M |
| 3300012349|Ga0137387_10626266 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012350|Ga0137372_10106182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2348 | Open in IMG/M |
| 3300012353|Ga0137367_10443304 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300012355|Ga0137369_10002491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 18926 | Open in IMG/M |
| 3300012356|Ga0137371_10387175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1085 | Open in IMG/M |
| 3300012356|Ga0137371_10779754 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012359|Ga0137385_10357040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1250 | Open in IMG/M |
| 3300012360|Ga0137375_10802836 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012362|Ga0137361_10188208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1863 | Open in IMG/M |
| 3300012362|Ga0137361_10194186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1834 | Open in IMG/M |
| 3300012363|Ga0137390_11378894 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012386|Ga0134046_1128892 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012386|Ga0134046_1266365 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012398|Ga0134051_1220841 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012683|Ga0137398_10685329 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012972|Ga0134077_10025881 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2053 | Open in IMG/M |
| 3300012976|Ga0134076_10236101 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012976|Ga0134076_10595339 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300014157|Ga0134078_10077732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1203 | Open in IMG/M |
| 3300014157|Ga0134078_10104150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1065 | Open in IMG/M |
| 3300015051|Ga0137414_1234063 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300015358|Ga0134089_10303641 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300017654|Ga0134069_1184259 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300017656|Ga0134112_10456704 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300017657|Ga0134074_1091949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1040 | Open in IMG/M |
| 3300017657|Ga0134074_1263310 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018468|Ga0066662_10647393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 998 | Open in IMG/M |
| 3300019255|Ga0184643_1020764 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300019255|Ga0184643_1251353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2076 | Open in IMG/M |
| 3300020199|Ga0179592_10443333 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021073|Ga0210378_10149952 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300022195|Ga0222625_1189678 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025318|Ga0209519_10453240 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300025318|Ga0209519_10763883 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025910|Ga0207684_10604685 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300025922|Ga0207646_10284869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1493 | Open in IMG/M |
| 3300025928|Ga0207700_11064119 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300026277|Ga0209350_1066989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1010 | Open in IMG/M |
| 3300026301|Ga0209238_1003634 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6157 | Open in IMG/M |
| 3300026301|Ga0209238_1186863 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300026313|Ga0209761_1141127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1147 | Open in IMG/M |
| 3300026313|Ga0209761_1204595 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300026318|Ga0209471_1000381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 31123 | Open in IMG/M |
| 3300026332|Ga0209803_1025850 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2839 | Open in IMG/M |
| 3300026334|Ga0209377_1007698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6317 | Open in IMG/M |
| 3300026523|Ga0209808_1056989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1756 | Open in IMG/M |
| 3300026528|Ga0209378_1198990 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026536|Ga0209058_1273621 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026547|Ga0209156_10133474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1211 | Open in IMG/M |
| 3300027181|Ga0208997_1074095 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300027388|Ga0208995_1024722 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300027655|Ga0209388_1025807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1665 | Open in IMG/M |
| 3300027681|Ga0208991_1137831 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300027862|Ga0209701_10009581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6314 | Open in IMG/M |
| 3300027875|Ga0209283_10527268 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300027882|Ga0209590_10954718 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027909|Ga0209382_11286061 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300028536|Ga0137415_10055179 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3840 | Open in IMG/M |
| 3300028536|Ga0137415_10365619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1246 | Open in IMG/M |
| 3300028802|Ga0307503_10906009 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031820|Ga0307473_10045555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2037 | Open in IMG/M |
| 3300031820|Ga0307473_10700802 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031823|Ga0307478_11514146 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031949|Ga0214473_11159526 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031962|Ga0307479_11844831 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032205|Ga0307472_102447434 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300032770|Ga0335085_10977883 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300033475|Ga0310811_11432939 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.59% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10023744 | 3300001086 | Forest Soil | MNLKVRQELIGIGALLVGLFLGLTLLPLSLTGSWGRAI |
| JGI12053J15887_102501702 | 3300001661 | Forest Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQ |
| JGI25385J37094_100403511 | 3300002558 | Grasslands Soil | MKQKARQELVGIGALAVGLFLGLTLLRLPITGSWGDRIGSLLWRV |
| JGI25390J43892_100825371 | 3300002911 | Grasslands Soil | MNAKARQELIGIGALVVGLFLGLTLLRLPVTGSWGDHIGSLLWRTLGA |
| JGI25390J43892_100874212 | 3300002911 | Grasslands Soil | MTPKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWR |
| JGI25390J43892_101425951 | 3300002911 | Grasslands Soil | VNTKARRELIGIGALVVGLFLGLTLFRLPITGSWGERVGG |
| JGI25386J43895_101183532 | 3300002912 | Grasslands Soil | MNRKARQELIGIGALVIGLFLGLTLLRLPITGRWGAQIGARLWYLLGVG |
| Ga0066672_107043731 | 3300005167 | Soil | MNAKARQELVGIGALVVGLFLGLTLLRLPITGSWGGRIGSLLWRTLGAGSAVL |
| Ga0066690_102884973 | 3300005177 | Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGS |
| Ga0066688_100481354 | 3300005178 | Soil | MNAKVRRELIGIGALVVGLFLGLTLLRLPITGSWGEHIGSRLWR |
| Ga0066684_100605711 | 3300005179 | Soil | MTSKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWR |
| Ga0066675_100697493 | 3300005187 | Soil | MTQKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSL |
| Ga0070708_1004789103 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKARQELIGIGALAIGLFLGLTLLRLPITGSWGDQIGS |
| Ga0070696_1002080481 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDEIGSRLWRVLGVGS |
| Ga0070696_1012096222 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSRLWRVL |
| Ga0066707_103862991 | 3300005556 | Soil | MNRKARQELVGIGALVIGLFLGLTLLRLPLTGSWGGTVGSQLWRVFGVGA |
| Ga0066707_108731622 | 3300005556 | Soil | MNRKARQELIGIGALAIGLFLGLTLLRLPITGSWGD |
| Ga0066704_103909403 | 3300005557 | Soil | MNPKARQELIGIAALLVGFFLGLTLLPVALTGSWG |
| Ga0066654_102391673 | 3300005587 | Soil | MNAKARQELVGIGALVVGLFLGLTLLRLPVTGSWGGRIGSL |
| Ga0066651_101170983 | 3300006031 | Soil | MNPKARHELIGIAALLVGFFLGLTLLPPPVALTGSWGRTIGGTCWQLF |
| Ga0075421_1014015242 | 3300006845 | Populus Rhizosphere | MNPKARNELIGVAALLLGLFFGLTLLQLPLTGSWGR |
| Ga0075435_1007078612 | 3300007076 | Populus Rhizosphere | MNPKARQELIGIAALLVGFFLGLTLVPPPMALTGSWGRAI |
| Ga0099830_108910251 | 3300009088 | Vadose Zone Soil | VNPKRQELLGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWRV |
| Ga0099828_102263663 | 3300009089 | Vadose Zone Soil | VNPKRQELLGIGALVVGLFLGLTLLRLPITGSWGERIG |
| Ga0105071_10880971 | 3300009808 | Groundwater Sand | MNRKARQELIGIGALVVGLFLGLTLLRLPITGTWGDRVGTLLWRMFGL |
| Ga0134082_101332831 | 3300010303 | Grasslands Soil | MNRKARQELIGIGALAIGLFLGLTLLRLPITGSWGDQIGSRLWRMLGV |
| Ga0134109_101868281 | 3300010320 | Grasslands Soil | MNRKARQELIGIGALAIGLFLGLTLLRLPITGSWGAQIGSRL |
| Ga0134067_104725191 | 3300010321 | Grasslands Soil | MTQKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWR |
| Ga0134084_103931232 | 3300010322 | Grasslands Soil | MNPKARQELVGIAALLVGFFLGLTLLPVSLTGSWGRAMGAALW |
| Ga0134064_104747341 | 3300010325 | Grasslands Soil | MTPKARQELVGIGALVVGLFLGLTLLRLPITGSWGERI |
| Ga0134063_101327471 | 3300010335 | Grasslands Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGAHIGARLWYLLGVGSVLL |
| Ga0134071_100748681 | 3300010336 | Grasslands Soil | VNTKARRELIGIGALVVGLFLGLTLFRLPITGSWGERVGGLLWRVF |
| Ga0134071_103234292 | 3300010336 | Grasslands Soil | MTPKARQELVGIGALVVGLFLGLTLLRLPITGSWGER |
| Ga0134062_102811441 | 3300010337 | Grasslands Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSRLWR |
| Ga0134122_103016271 | 3300010400 | Terrestrial Soil | MNPKARNELIGVAALLLGLFFGLTLLQLPLTGSWGRQI |
| Ga0137392_112048341 | 3300011269 | Vadose Zone Soil | VNPKRQELLGIGALVVGLFLGLTLLRLPITGSWGERI |
| Ga0137464_10214283 | 3300011434 | Soil | MNPKARPELIGIAALLVGLFLGLTLLPVALTGSWGRTIGGALW |
| Ga0137453_10368202 | 3300012034 | Soil | MNPKARQELIGIAALLVGFFLGLTLLPVALTGSWGR |
| Ga0137388_105639723 | 3300012189 | Vadose Zone Soil | MNPKGGGRGGARQELLGITALLVGFFLGLAPLPVAPTGSWGRTIGG |
| Ga0137364_100216781 | 3300012198 | Vadose Zone Soil | MTQKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWRVFGAG |
| Ga0137387_101944213 | 3300012349 | Vadose Zone Soil | MKQKARQELVGIGALAVGLFLGLTLLRLPITGSWGDRI |
| Ga0137387_106262661 | 3300012349 | Vadose Zone Soil | MKPKARQELIGIAALLVGFFLGLTLLPVALTGSWGRTIGSTLWQL |
| Ga0137372_101061822 | 3300012350 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSRLWRVLGVG* |
| Ga0137367_104433041 | 3300012353 | Vadose Zone Soil | MKGKVRQELIGIGALAVGLFLGLTLLRLPITGSWGDRIGSML |
| Ga0137369_1000249119 | 3300012355 | Vadose Zone Soil | MNRKARQELVGIGALVVGLFLGLTLLRLPITGSWGE |
| Ga0137371_103871753 | 3300012356 | Vadose Zone Soil | MNAKARQELIGIGALVVGLFLGLTLLRLPITGSWGDH |
| Ga0137371_107797542 | 3300012356 | Vadose Zone Soil | MKKKARQELIGIGALAAGLFLGLTLLPWHITGDWGERVGRLL |
| Ga0137385_103570401 | 3300012359 | Vadose Zone Soil | MNPKARQELIGIAALLVGVFLGLTLLPPPVAVTGS |
| Ga0137375_108028362 | 3300012360 | Vadose Zone Soil | MNSKARQELIGIAALLVGFFLGLTLLPVALTGSWGRALGH |
| Ga0137361_101882083 | 3300012362 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSRLW |
| Ga0137361_101941863 | 3300012362 | Vadose Zone Soil | MNPKARPELIGIAALLVGFFLGLTLLPVALTGSWGRTIGNALW |
| Ga0137390_113788942 | 3300012363 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDRIGSLLWHVLGVG |
| Ga0134046_11288922 | 3300012386 | Grasslands Soil | MNPKARQELVGIAALLVGFFLGLTLLPVSLTGSWG |
| Ga0134046_12663651 | 3300012386 | Grasslands Soil | MNLKARQELIGIAALLVGLFVGLTLLPVGLTGSWGRTI |
| Ga0134051_12208411 | 3300012398 | Grasslands Soil | MNRKARQELIGIGALAIGLFLGLTLLRLPITGSWGDQIGSRLWRVL |
| Ga0137398_106853291 | 3300012683 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSRLWRV |
| Ga0134077_100258813 | 3300012972 | Grasslands Soil | VNAKARRELIGIGALVVGLFLGLTLFRLPITGSWGERVGGLLWRVFG |
| Ga0134076_102361011 | 3300012976 | Grasslands Soil | MNPRGRQELIGIGALAVGVFLGLTLLGTPVTGSWGSR |
| Ga0134076_105953392 | 3300012976 | Grasslands Soil | MNRKARQELIGIAALVIGLFLGLTLLRLPITGSWGDQ |
| Ga0134078_100777323 | 3300014157 | Grasslands Soil | MNAKARQELIGIGALVIGLFLGLTLLRLPITGSWGDRIGSLLW |
| Ga0134078_101041501 | 3300014157 | Grasslands Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGAQIGSRLWRVLGVGS |
| Ga0137414_12340631 | 3300015051 | Vadose Zone Soil | MNPKGRQELLGVAALLVGFFLGLTLLPVALTGSWGRTIGGGGALWQLFG |
| Ga0134089_103036412 | 3300015358 | Grasslands Soil | MNRKARQELIGIAALVIGLFLGLTLLRLPITGSWGEQIGSRLW |
| Ga0134069_11842592 | 3300017654 | Grasslands Soil | MKPKARQELIGIAALLVGFFLGLTLLPVALTGSWGRT |
| Ga0134112_104567042 | 3300017656 | Grasslands Soil | MNPKARQELIGIAALLVGFFLGLTLLPVALTGSWGRTIG |
| Ga0134074_10919491 | 3300017657 | Grasslands Soil | MTPKARQELVGIGALVVGLFLGLTLLRLPITGSWGQRIGSLLWRVFGAG |
| Ga0134074_12633101 | 3300017657 | Grasslands Soil | MNRKARQELIGIGALAIGLFLGLTLLRLPITGSWGDQIGSRLWRMLGVG |
| Ga0066662_106473933 | 3300018468 | Grasslands Soil | MNRKARQELIGIGALVIGLFLGLTLLRLSITGSWGDH |
| Ga0184643_10207642 | 3300019255 | Groundwater Sediment | MNSKARNELIGVAALLLGLFFGLTLLQVPLTGSWGRAIGALLWK |
| Ga0184643_12513531 | 3300019255 | Groundwater Sediment | MNSKARQELIGIAALLVGSFLGLTLLPVALTGSWGRTTGNALW |
| Ga0179592_104433331 | 3300020199 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDR |
| Ga0210378_101499522 | 3300021073 | Groundwater Sediment | MNLKARQELIGIAALLVGLFLGLTLLPVALTGSWGRNI |
| Ga0222625_11896781 | 3300022195 | Groundwater Sediment | MNPKARNELIGIAALLLGLFFGLTLLQLPLTGSWGRSIGGML |
| Ga0209519_104532402 | 3300025318 | Soil | MNPKAHHRQELLGIAALLVGLFLGLTLLQLPITGSWGGGIGGLLWK |
| Ga0209519_107638832 | 3300025318 | Soil | MNPKARNELIGVAALLLGLFFGLTLLQLPLTGSWGRAIGGML |
| Ga0207684_106046853 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDEIGS |
| Ga0207646_102848691 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDRIGSLLWHVLGVGSV |
| Ga0207700_110641191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAKVRRELIGIGALVVGLFLGLTLLRLSITGNWGEHI |
| Ga0209350_10669891 | 3300026277 | Grasslands Soil | VNTKARRELIGIGALVVGLFLGLTLFRLPITGSWGERVGGLLWRVFGVGS |
| Ga0209238_10036348 | 3300026301 | Grasslands Soil | MTSKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWRVFGA |
| Ga0209238_11868631 | 3300026301 | Grasslands Soil | VNPKARRELLGIGALVVGLFLGLTLFRLPITGSWGERVGGLLW |
| Ga0209761_11411271 | 3300026313 | Grasslands Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIG |
| Ga0209761_12045951 | 3300026313 | Grasslands Soil | MTSKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWRVCG |
| Ga0209471_100038128 | 3300026318 | Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSR |
| Ga0209803_10258501 | 3300026332 | Soil | VNTKARRELIGIGALVVGLFLGLTLFRLPITGSWGERVGGLLWRV |
| Ga0209377_10076981 | 3300026334 | Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIASRL |
| Ga0209808_10569893 | 3300026523 | Soil | MNAKARQELIGIGALVVGLFLGLTLLRLPVTGSWGD |
| Ga0209378_11989902 | 3300026528 | Soil | MNRKAHQELVGIGALVIGLFLGLTLLRLPLTGSWGGTVG |
| Ga0209058_12736211 | 3300026536 | Soil | MNPKARQELVGIAALLVGFFLGLTLLPVSLTGSWGRA |
| Ga0209156_101334743 | 3300026547 | Soil | VKQKARQELVGIGALVVGLFLGLTLLRLPITGSWGDRIGSQLWR |
| Ga0208997_10740951 | 3300027181 | Forest Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWG |
| Ga0208995_10247222 | 3300027388 | Forest Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDAIG |
| Ga0209388_10258071 | 3300027655 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDRIGS |
| Ga0208991_11378312 | 3300027681 | Forest Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQIGSRSCKHSLGLAG |
| Ga0209701_100095811 | 3300027862 | Vadose Zone Soil | VNPKARQELLGIGALVVGLFLGLTLLRLPITGSWGER |
| Ga0209283_105272681 | 3300027875 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDQI |
| Ga0209590_109547181 | 3300027882 | Vadose Zone Soil | MNRKARQELIGIGALAVGLFLGLTVLRLPITGSWGDEIGSRLWRVLGVGSV |
| Ga0209382_112860612 | 3300027909 | Populus Rhizosphere | MNPKARNELIGVAALLLGLFFGLTLLQLPLTGSWGRA |
| Ga0137415_100551795 | 3300028536 | Vadose Zone Soil | MTPKARQELVGIGALVVGLFLGLTLLRLPITGSWGERIGSLLWRVFGA |
| Ga0137415_103656191 | 3300028536 | Vadose Zone Soil | MNPKARQELIGIGALVVGLFLGLTLLRLPITGRWGQGI |
| Ga0307503_109060091 | 3300028802 | Soil | VTPRVREELIGIGALVVGVFLGLTLLGTQVTGSWG |
| Ga0307473_100455553 | 3300031820 | Hardwood Forest Soil | MNRKARQELIGIGALAVGLFLGLTLLRLPITGSWGDRIGSLLWHVL |
| Ga0307473_107008021 | 3300031820 | Hardwood Forest Soil | MNPKARQELIGIAALLVGFFLGLTLLPVALTGSWGRALGA |
| Ga0307478_115141461 | 3300031823 | Hardwood Forest Soil | MTGRGRQELVGVGALVVGVFLGLTLLGTGLTGSWG |
| Ga0214473_111595261 | 3300031949 | Soil | MNPKARQELFGVAALVAGLFLGLTLLPVGFTGPWGRA |
| Ga0307479_118448312 | 3300031962 | Hardwood Forest Soil | MTARGREELVGIGALAVGVFLGLTLLETPLTGSWGARLGLGL |
| Ga0307472_1024474341 | 3300032205 | Hardwood Forest Soil | MNAKVRRELIGIGALVVGLFLGLTLLRLSITGNWGEHIGSLLWRL |
| Ga0335085_109778831 | 3300032770 | Soil | VNPRVREELIGIGALVVGVFLGLTLLGTQVTGSWGRGRRR |
| Ga0310811_114329392 | 3300033475 | Soil | MNPKARQELIGIAALLLGFFLGLTLLPVSWTGSWGQSIGGT |
| ⦗Top⦘ |