| Basic Information | |
|---|---|
| Family ID | F088402 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TRLRESRELELRVLTLPSARELLASEGIELISYRDLTP |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 89.91 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.991 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment (10.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.018 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.954 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 31.19 |
| PF13439 | Glyco_transf_4 | 9.17 |
| PF03729 | DUF308 | 2.75 |
| PF08281 | Sigma70_r4_2 | 2.75 |
| PF03544 | TonB_C | 0.92 |
| PF13385 | Laminin_G_3 | 0.92 |
| PF05163 | DinB | 0.92 |
| PF07694 | 5TM-5TMR_LYT | 0.92 |
| PF12760 | Zn_Tnp_IS1595 | 0.92 |
| PF09411 | PagL | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 2.75 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.99 % |
| Unclassified | root | N/A | 11.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001083|JGI12678J13193_1004534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 587 | Open in IMG/M |
| 3300001084|JGI12648J13191_1010821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300001546|JGI12659J15293_10016642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1976 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101276848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 625 | Open in IMG/M |
| 3300002568|C688J35102_119111424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300002568|C688J35102_119648734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 740 | Open in IMG/M |
| 3300002917|JGI25616J43925_10338254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10063169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1431 | Open in IMG/M |
| 3300004152|Ga0062386_100027524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4199 | Open in IMG/M |
| 3300005176|Ga0066679_10950479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
| 3300005181|Ga0066678_10543754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300005436|Ga0070713_100396134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1289 | Open in IMG/M |
| 3300005436|Ga0070713_101733711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 606 | Open in IMG/M |
| 3300005468|Ga0070707_100576807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300005533|Ga0070734_10453499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300005533|Ga0070734_10902466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
| 3300005566|Ga0066693_10170936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300005587|Ga0066654_10201604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300005602|Ga0070762_11319270 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005712|Ga0070764_10652452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
| 3300005921|Ga0070766_10421313 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005993|Ga0080027_10485042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300006052|Ga0075029_101180093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300006059|Ga0075017_100073969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2332 | Open in IMG/M |
| 3300006059|Ga0075017_101228445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300006102|Ga0075015_100810206 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006162|Ga0075030_100038150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4067 | Open in IMG/M |
| 3300006162|Ga0075030_100318351 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300006881|Ga0068865_100057507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 2713 | Open in IMG/M |
| 3300009545|Ga0105237_12028365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300009548|Ga0116107_1115697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300009624|Ga0116105_1052311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300009683|Ga0116224_10597180 | Not Available | 527 | Open in IMG/M |
| 3300009698|Ga0116216_10044321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2750 | Open in IMG/M |
| 3300009700|Ga0116217_10925202 | Not Available | 534 | Open in IMG/M |
| 3300010366|Ga0126379_13223331 | Not Available | 546 | Open in IMG/M |
| 3300010379|Ga0136449_102726898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300012207|Ga0137381_11408779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012354|Ga0137366_10627891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300012363|Ga0137390_10221163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1880 | Open in IMG/M |
| 3300012927|Ga0137416_12265917 | Not Available | 500 | Open in IMG/M |
| 3300013105|Ga0157369_10437095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300013296|Ga0157374_10738154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300014489|Ga0182018_10007098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8635 | Open in IMG/M |
| 3300016270|Ga0182036_11435278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300016341|Ga0182035_11972619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300017822|Ga0187802_10248916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300017823|Ga0187818_10165812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300017924|Ga0187820_1007735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2539 | Open in IMG/M |
| 3300017924|Ga0187820_1214948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017927|Ga0187824_10292447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300017930|Ga0187825_10402886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017955|Ga0187817_10713819 | Not Available | 640 | Open in IMG/M |
| 3300017955|Ga0187817_11125812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300017970|Ga0187783_11277563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300017975|Ga0187782_10340293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300017993|Ga0187823_10271780 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300017995|Ga0187816_10203951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
| 3300017995|Ga0187816_10207549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300018088|Ga0187771_11463291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300018468|Ga0066662_11071624 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300020580|Ga0210403_10496998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300020582|Ga0210395_11294653 | Not Available | 534 | Open in IMG/M |
| 3300021404|Ga0210389_10030231 | All Organisms → cellular organisms → Bacteria | 4164 | Open in IMG/M |
| 3300021404|Ga0210389_10514870 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021432|Ga0210384_10528587 | Not Available | 1061 | Open in IMG/M |
| 3300021475|Ga0210392_11100824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300024186|Ga0247688_1066551 | Not Available | 596 | Open in IMG/M |
| 3300025434|Ga0208690_1060966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300025928|Ga0207700_11309500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300025938|Ga0207704_10037735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2794 | Open in IMG/M |
| 3300026023|Ga0207677_11217967 | Not Available | 689 | Open in IMG/M |
| 3300026078|Ga0207702_11356301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300027076|Ga0208860_1036544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300027313|Ga0207780_1028656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
| 3300027546|Ga0208984_1111479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300027609|Ga0209221_1171012 | Not Available | 533 | Open in IMG/M |
| 3300027812|Ga0209656_10337755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300027826|Ga0209060_10593381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300027853|Ga0209274_10355507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300027889|Ga0209380_10415637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300027898|Ga0209067_10257984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300027911|Ga0209698_11207899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300028813|Ga0302157_10151425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1379 | Open in IMG/M |
| 3300028906|Ga0308309_11489190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300029943|Ga0311340_11397718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300030044|Ga0302281_10111831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300030520|Ga0311372_10704082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300030878|Ga0265770_1011345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1307 | Open in IMG/M |
| 3300031057|Ga0170834_114045789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300031128|Ga0170823_14558781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300031231|Ga0170824_107355815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300031716|Ga0310813_10215884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1581 | Open in IMG/M |
| 3300031718|Ga0307474_11061343 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031718|Ga0307474_11113067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300031754|Ga0307475_11060885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300031823|Ga0307478_11270971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300031823|Ga0307478_11385884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031962|Ga0307479_10900728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300031962|Ga0307479_11558676 | Not Available | 617 | Open in IMG/M |
| 3300032076|Ga0306924_11286599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300032205|Ga0307472_100720930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300032205|Ga0307472_102679307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300032782|Ga0335082_10644126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300032783|Ga0335079_10739373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300032805|Ga0335078_10218279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2630 | Open in IMG/M |
| 3300033402|Ga0326728_10215699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1898 | Open in IMG/M |
| 3300033806|Ga0314865_211053 | Not Available | 522 | Open in IMG/M |
| 3300034065|Ga0334827_026070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2358 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.92% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.92% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12678J13193_10045342 | 3300001083 | Forest Soil | RLRQSRETELHVLTLPAARELLMQQDIELISYRELVDKPFSR* |
| JGI12648J13191_10108212 | 3300001084 | Forest Soil | ESREMELRVLTLPAAREVLLQEGIELISYRDLGAKPSR* |
| JGI12659J15293_100166421 | 3300001546 | Forest Soil | TRLRESREMELRVLTLPAAREVLLQEGIELISYRDLGAKPSR* |
| JGIcombinedJ26739_1012768481 | 3300002245 | Forest Soil | STTRLRESRETELAVLTLPAARSLLSAEGIALISYRDLLAFPHL* |
| C688J35102_1191114241 | 3300002568 | Soil | AAHTRLRESRELELKVLTLPAAREVLADAGVQLISYRDLPGNG* |
| C688J35102_1196487342 | 3300002568 | Soil | PGYNDADLQKANTRLRASREMELRVLTLPGARGILEERGIQLISYSDLAAS* |
| JGI25616J43925_103382542 | 3300002917 | Grasslands Soil | LRAAKTRLRESRETELAVLTLPAARSVLSEEGIALISYRDFLAQPHL* |
| JGIcombinedJ51221_100631691 | 3300003505 | Forest Soil | TRLRSSREVELRVLTLPAAREVLAQEGIELISYRELKFSRISL* |
| Ga0062386_1000275245 | 3300004152 | Bog Forest Soil | YNDDDLQSAKTRLRTSRETELRVLTMPQARELLSQQGVELISYRELIPAPISR* |
| Ga0066679_109504791 | 3300005176 | Soil | TRLRESREIELAVLTRPEARQLLSEEGIKLISYQDLRPH* |
| Ga0066678_105437542 | 3300005181 | Soil | RLRESRQTELQVLTSPHARKMLSDQGIALISYHDLNSSS* |
| Ga0070713_1003961343 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DLQKANTRLRESREIELRVLTLPAARTILAQQGVQLISYRDLTTP* |
| Ga0070713_1017337111 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DLQTGKTRLRESRETELRVLTLPAAREVLSHQGIELISYYDLLGKHDSK* |
| Ga0070707_1005768071 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RESRETELRVLTMPEARELLLDQGIDLISYRELISSRANA* |
| Ga0070734_104534991 | 3300005533 | Surface Soil | RESRELELHVLTLPAARAMLAQHGIKLISYRDLDAASV* |
| Ga0070734_109024661 | 3300005533 | Surface Soil | KTRLRDSRETELRVLTLPAAREVLSQEGIQLISYRDLDPNPATTKG* |
| Ga0066693_101709361 | 3300005566 | Soil | GYNDADLQKANTRLRESRETELRVLTLPAAREILEQKGIQLISYRDLVARA* |
| Ga0066654_102016041 | 3300005587 | Soil | ESREMELHALTLPAARETLVQQGIQLISYRELSVQ* |
| Ga0070762_113192701 | 3300005602 | Soil | ETELRVLTLPAARDVLAQQGIELISYRDLPPNPGFREGRYC* |
| Ga0070764_106524522 | 3300005712 | Soil | TRLRESRETELHVLTLAAAREVLAHQGIQLISYRDLARTG* |
| Ga0070766_104213132 | 3300005921 | Soil | NDSDLQLGKTRLRASRETELRVLTLPAARDVLAQQGIELISYRDLPPNPGFREGRYC* |
| Ga0080027_104850422 | 3300005993 | Prmafrost Soil | ADLQTVQTRLRDSRAEELRVLTSPAARELLGDNGIELISYHDFARTAE* |
| Ga0075029_1011800932 | 3300006052 | Watersheds | TRLRESRELELRVLTLPSARELLASEGIELISYRDLTP* |
| Ga0075017_1000739691 | 3300006059 | Watersheds | SARTRLRESREVELHVLTSPGAREILTRHGVELISYRDLGTR* |
| Ga0075017_1012284451 | 3300006059 | Watersheds | QTAKTRLRESRELELRVLTLPSARELLAREGVQLISYRDLTA* |
| Ga0075015_1008102061 | 3300006102 | Watersheds | AKTRLRESREVELHVLTSPRAKEILARQGVELISYRDLAEQ* |
| Ga0075030_1000381505 | 3300006162 | Watersheds | QRSKTRLRESREMELRALTLPAAREMLAQQGIELISYRDLGAG* |
| Ga0075030_1003183513 | 3300006162 | Watersheds | SKTRLRASRETELRVLTLPAARDVLAQQGIELISYRDLSGRP* |
| Ga0068865_1000575071 | 3300006881 | Miscanthus Rhizosphere | ARTRLRESREVELHVLTSPGAREILTQHGVELISYRDLGEG* |
| Ga0105237_120283651 | 3300009545 | Corn Rhizosphere | YNDADLQNAKTRLRESRETELRVLTLPGAREILEQKRIQLISYRDLVVGV* |
| Ga0116107_11156972 | 3300009548 | Peatland | NTRLRESREIELRVLTMPEVRELLLNCGVALVSYRELVSAEVGQ* |
| Ga0116105_10523111 | 3300009624 | Peatland | ADLGAAKTRLRESRETELHALTLPEARNTLSQAGIDLISYRDLHR* |
| Ga0116224_105971801 | 3300009683 | Peatlands Soil | RESREVELDVLTSPRAREILARQGVELISYRDLVER* |
| Ga0116216_100443214 | 3300009698 | Peatlands Soil | EIELRVLTLPAAREVLAQEGIELISYRELAPQRSP* |
| Ga0116217_109252021 | 3300009700 | Peatlands Soil | SDLQSAKTRLRESREVELDVLTSPRARETLARQGVELVSYRDLVER* |
| Ga0126379_132233311 | 3300010366 | Tropical Forest Soil | DSDLQSAKTRLRESREVEFRVLTLPHAREILAQQAIELISYRDLAER* |
| Ga0136449_1027268982 | 3300010379 | Peatlands Soil | NDADLQAGKTRLRNSREIELHVLTLPAAREVLAQEGIDLISYRELAPQRSP* |
| Ga0137381_114087791 | 3300012207 | Vadose Zone Soil | RLRESREKELRVLTLPAAREVLAQQGVELTSYRDLALKGP* |
| Ga0137366_106278911 | 3300012354 | Vadose Zone Soil | NDADLQASKTRLRESRETELRVLTLPAAREVLSQQGIELISYRELASNPGSH* |
| Ga0137390_102211633 | 3300012363 | Vadose Zone Soil | VRTRLRASRQLELQVLTSADARCLLDKSGVELISYRELS* |
| Ga0137416_122659172 | 3300012927 | Vadose Zone Soil | RTRLRASRQLELQVLTSAEARSSLDKSGVELISYRDLS* |
| Ga0157369_104370951 | 3300013105 | Corn Rhizosphere | DADLRSTNTRLRESRETELRVLTLPAAREILEQKGIELISYRDL* |
| Ga0157374_107381542 | 3300013296 | Miscanthus Rhizosphere | LRESRETELRVLTLPAAREILEQKGIQLISYRDLVAGA* |
| Ga0182018_1000709811 | 3300014489 | Palsa | SANTRLRESRETELRLLTMPEARELLLTQGIALVSYRDLILANTLE* |
| Ga0182036_114352781 | 3300016270 | Soil | RLRESREIELHVLTLPAAREILAAEGVELISYREL |
| Ga0182035_119726191 | 3300016341 | Soil | LAAAKTRLRQSRELELHVLTMPEARNILAQRDIQLISYHDLRQTA |
| Ga0187802_102489162 | 3300017822 | Freshwater Sediment | ESREKELRVLTLPEAREMLSNQGISLISYRDLVAQESSL |
| Ga0187818_101658121 | 3300017823 | Freshwater Sediment | RLRESREKELRVLTLPEAREMLSNQGISLISYRDLVAQESSL |
| Ga0187820_10077351 | 3300017924 | Freshwater Sediment | RTRLRASREIELRVLTLPAARKLLESEGIKLISYRELAKS |
| Ga0187820_12149481 | 3300017924 | Freshwater Sediment | ESREAELRLLTTPEARQLLSNLGVSLISYRDLGEET |
| Ga0187824_102924472 | 3300017927 | Freshwater Sediment | AKTRLRESRETELRVLTLPAARDVLAKEGIELISYRELTGPAGS |
| Ga0187825_104028861 | 3300017930 | Freshwater Sediment | LMAAKTRLRESRETELKVLTLPAARDILAQNQIELISYRDLVAS |
| Ga0187817_107138191 | 3300017955 | Freshwater Sediment | SAKTRLRESREVELHVLTSPTAREILARQGVELISYRDLVER |
| Ga0187817_111258122 | 3300017955 | Freshwater Sediment | ETELRVLTLPAARDLLAHEGIQLISYHDLAREAEAS |
| Ga0187783_112775631 | 3300017970 | Tropical Peatland | RASREIELRVLTLPAARQLLSSEGIELISYRDLTTK |
| Ga0187782_103402931 | 3300017975 | Tropical Peatland | RDLQAARTRLRQSREEELRILTLPAARDALSNEGIELISYRDLK |
| Ga0187823_102717801 | 3300017993 | Freshwater Sediment | TRLRESRAQELHLLTSPSAREILERNDVELISYRDLVGVRN |
| Ga0187816_102039513 | 3300017995 | Freshwater Sediment | LRESRETELRVLTLPTARDVLSREGIELISYHDLVPMP |
| Ga0187816_102075491 | 3300017995 | Freshwater Sediment | NDADLQAAGTRLRQSREEELRVLTLPAARAVLAQEGIAPISYHDLK |
| Ga0187771_114632911 | 3300018088 | Tropical Peatland | QAASTRLRQSREVELRVLTLPTAREVLSREGIELISYRDLRSA |
| Ga0066662_110716242 | 3300018468 | Grasslands Soil | SSVRTRLRASREAELRVLTSPRAREIIASRGIELISFADL |
| Ga0210403_104969982 | 3300020580 | Soil | DADLQAGKTRLRQSRETELHVLTLPAAREVLSEQGIELISYRDLAP |
| Ga0210395_112946532 | 3300020582 | Soil | AKPRLRESRETELHALTLPEARNTLAQDGIDLISYRDL |
| Ga0210389_100302311 | 3300021404 | Soil | SAHTRLRASREIELRVLTLPAAREVLAREGIELISYHDLARTT |
| Ga0210389_105148702 | 3300021404 | Soil | KTRLRDSREAELRTLTLPASREILAQAGIELISYRALTI |
| Ga0210384_105285871 | 3300021432 | Soil | DDLRTARTRLRESRESELAVLTRPEARQLLLQEGIKLISYQDLRPC |
| Ga0210392_111008242 | 3300021475 | Soil | ANTRLRESREIELRVLTMPEARELLLQQGIELLSYRDLVETGTQA |
| Ga0247688_10665512 | 3300024186 | Soil | NDSELQSAKTRLRESREVELRVLTLPAARGILERQGVQLISYREL |
| Ga0208690_10609662 | 3300025434 | Peatland | PGYNDADLGAAKTRLRESRETELRALTLPEARATLSQAGIDLISYRDLRP |
| Ga0207700_113095001 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DLQTGKTRLRESRETELRVLTLPAAREVLSHQGIELISYYDLLGKHDSK |
| Ga0207704_100377351 | 3300025938 | Miscanthus Rhizosphere | LRESREVELHVLTSPGAREILTQHGVELISYRDLGEG |
| Ga0207677_112179672 | 3300026023 | Miscanthus Rhizosphere | LRESREVELDVLTSPRAREILARQGVELISYRDLLER |
| Ga0207702_113563011 | 3300026078 | Corn Rhizosphere | PGYNDVDLQKANTRLRESRETELRVLTLPAAREILEQKGIQLISYRDLVAGA |
| Ga0208860_10365441 | 3300027076 | Forest Soil | DADLQAANTRLRESRETELRVLTLPQVRQMLLHHKIDLISYRDLMPTESGP |
| Ga0207780_10286562 | 3300027313 | Tropical Forest Soil | KTRLRESRELELRVLTMPQARELLAKNGIQLISYRELPQTT |
| Ga0208984_11114791 | 3300027546 | Forest Soil | LRESRETELAILTRPEARQLLSQEGIKLISYRDLSAR |
| Ga0209221_11710121 | 3300027609 | Forest Soil | DADLAAAKTRLRESRETELRALTLPEARNTLSQFGIDLTSYRDLCR |
| Ga0209656_103377551 | 3300027812 | Bog Forest Soil | NDDDLQSAKTRLRTSRETELRVLTMPQARELLSQQGVELISYRELIPAPISR |
| Ga0209060_105933811 | 3300027826 | Surface Soil | KTRLRDSRETELRVLTLPAAREVLSQEGIQLISYRDLDPNPATTKG |
| Ga0209274_103555072 | 3300027853 | Soil | QAGKTRLRESREIELRVLTLPAAREVLAQQGIELISYRELAPNHSSR |
| Ga0209380_104156371 | 3300027889 | Soil | NDSDLQLGKTRLRASRETELRVLTLPAARDVLAQQGIELISYRDLPPNPGFREGRYC |
| Ga0209067_102579842 | 3300027898 | Watersheds | LRESREIELRVLTLPAAREMLAQEGVQLISYRDLLGTP |
| Ga0209698_112078992 | 3300027911 | Watersheds | DADLQASKTRLRASRETELRVLTLPAARDVLAQQGIELISYRDLSGRP |
| Ga0302157_101514251 | 3300028813 | Bog | NDEDLKSSKTRLRESRETELRVLTMPESREIFAQHEIELISYRDLTSPI |
| Ga0308309_114891901 | 3300028906 | Soil | KTRLRQSRETELHALTLPEARNTLSQAGIELISYRDL |
| Ga0311340_113977182 | 3300029943 | Palsa | RLRESRETELRVLTLPAARKLLEDRCIALISYRDLISTETGS |
| Ga0302281_101118311 | 3300030044 | Fen | SSKTRLRESRETELRVLTMPESREIFAQHEIELISYRDLTSPI |
| Ga0311372_107040821 | 3300030520 | Palsa | RLRESRETELRVLTLDSARDVLTRAEIELISYHDLSN |
| Ga0265770_10113451 | 3300030878 | Soil | KTRLRESREIELRVLTLPAARKLLAQQGIELISYRELGPKHG |
| Ga0170834_1140457891 | 3300031057 | Forest Soil | QAGKTRLRESRETELRVLALPAAREVLAQQGIELISYHDLAPKPALP |
| Ga0170823_145587812 | 3300031128 | Forest Soil | RETELRVLALPAAREVLAQQGIELISYHDLAPKPALP |
| Ga0170824_1073558151 | 3300031231 | Forest Soil | DADLWAAKTRLRESRELELKVLTMPSAREVLAQAGVQLISYRDLLADMHA |
| Ga0310813_102158843 | 3300031716 | Soil | RLRESRETELRVLTLPAARELLNQKGIQLISYRDLVAGT |
| Ga0307474_110613432 | 3300031718 | Hardwood Forest Soil | GYNDDDLQSVNTRLRESRETELRVLTMPESRELLSNEGIALISYHELISNKTIP |
| Ga0307474_111130672 | 3300031718 | Hardwood Forest Soil | NDVDLQAGKTRLRQSREVELRVLTLPTAREVLTQQGIELISYRELSAKPGSSQQA |
| Ga0307475_110608851 | 3300031754 | Hardwood Forest Soil | RESRELELKVLTMPAAREALAQAGVQIISYRDLIANP |
| Ga0307478_112709712 | 3300031823 | Hardwood Forest Soil | NDADLQTAHTRLRESRETELRVLTLPGARELLEREGVQLISYRDLVGQNE |
| Ga0307478_113858841 | 3300031823 | Hardwood Forest Soil | KTRLRESRELELKVLTMPAAREVLAQAGVQLISYRDLLMNM |
| Ga0307479_109007282 | 3300031962 | Hardwood Forest Soil | ESRATELHALTLPGARESLASKGIALISYDDLTLSPK |
| Ga0307479_115586761 | 3300031962 | Hardwood Forest Soil | TAKTRLRESREVELGVLTSPRAREILARQGIELISY |
| Ga0306924_112865992 | 3300032076 | Soil | SAKTRLRESREIELHVLTLPAAREILAAEGVELISYREL |
| Ga0307472_1007209302 | 3300032205 | Hardwood Forest Soil | RLRESRELELKVLTMPAARETLLQAGVQLISYNDLLTNV |
| Ga0307472_1026793071 | 3300032205 | Hardwood Forest Soil | SARTRLRESRETELRVLTMPEARELLINQEISLISYRELTAGENGR |
| Ga0335082_106441261 | 3300032782 | Soil | QAAKTRLRESREAELKVLTLPASRQVLAGAGIELISYRDLVPA |
| Ga0335079_107393731 | 3300032783 | Soil | KTRLRESREVELDVLTSPRTREILARQGVELISYRDLVER |
| Ga0335078_102182791 | 3300032805 | Soil | RLRESRETELQVLTLPTARDVLSREGIELISYHDLVPTP |
| Ga0326728_102156993 | 3300033402 | Peat Soil | ARTRLRQSREEELRVLTLPAARGVLSQEGIDLISYHDLK |
| Ga0314865_211053_2_136 | 3300033806 | Peatland | AVKTRLRESRAQELQVLTSAAAREMLSQHGVELISYRDLATSSS |
| Ga0334827_026070_66_194 | 3300034065 | Soil | MTRLRESREIELRVLTLPAAREVLAQQGIELISYRELAPKAG |
| ⦗Top⦘ |