| Basic Information | |
|---|---|
| Family ID | F088397 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEVHAAV |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 70.64 % |
| % of genes near scaffold ends (potentially truncated) | 96.33 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.982 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (52.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.046 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (48.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01828 | Peptidase_A4 | 5.50 |
| PF13828 | DUF4190 | 2.75 |
| PF03007 | WES_acyltransf | 2.75 |
| PF12697 | Abhydrolase_6 | 2.75 |
| PF03466 | LysR_substrate | 0.92 |
| PF13669 | Glyoxalase_4 | 0.92 |
| PF07690 | MFS_1 | 0.92 |
| PF13404 | HTH_AsnC-type | 0.92 |
| PF08241 | Methyltransf_11 | 0.92 |
| PF02738 | MoCoBD_1 | 0.92 |
| PF11716 | MDMPI_N | 0.92 |
| PF07676 | PD40 | 0.92 |
| PF07350 | DUF1479 | 0.92 |
| PF00128 | Alpha-amylase | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF00578 | AhpC-TSA | 0.92 |
| PF11611 | DUF4352 | 0.92 |
| PF00571 | CBS | 0.92 |
| PF12802 | MarR_2 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 2.75 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.92 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.92 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.92 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.98 % |
| All Organisms | root | All Organisms | 22.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 52.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00348330 | 2166559006 | Grass Soil | MAVVADAGEPLSPQAADLVRRVARVFLDEPADLMAEAARGRLGRGR |
| E41_01178960 | 2170459005 | Grass Soil | MAVVPDAGKPLSPQAADLTRRVARVVLGEPADLMAEVHAAVLAG |
| Ga0066388_1038525141 | 3300005332 | Tropical Forest Soil | VPDAGELLSPQAADLAHRIARVFLDEPAELMDQVHAAVSAAA |
| Ga0070666_101805824 | 3300005335 | Switchgrass Rhizosphere | MAVVPEAGEPLSPQAADLVRRIARTVLDEPADLMDQVHAAVS |
| Ga0070695_1015213012 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVVPDAGESLSPEAADLVRRVARVFLDEPADLMAEVHAAVSAAADEP |
| Ga0066903_1054706641 | 3300005764 | Tropical Forest Soil | VPDTGEPLSPQAADLARRIARMFLDEPAELMDQVHAAVS |
| Ga0068865_1010739471 | 3300006881 | Miscanthus Rhizosphere | MAVVPEAGEPLSPQAADLVRRIARTVLDEPADLMDQ |
| Ga0066709_1038746311 | 3300009137 | Grasslands Soil | MAVVPDAGEPLSPQAADLIRRIARVVLDEPADLMAEVQA |
| Ga0116224_101952962 | 3300009683 | Peatlands Soil | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEVHAAVSA |
| Ga0116216_101432761 | 3300009698 | Peatlands Soil | MAVVADAGEPLSPQAADLVRRVARVFLDEPADLMAEVHAAVLAAADEPL |
| Ga0116216_101769081 | 3300009698 | Peatlands Soil | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEVHA |
| Ga0126379_101115542 | 3300010366 | Tropical Forest Soil | PARCRAPLSPQAADLVRRIARMVLNEPADLMAEVHAAVFAAAD* |
| Ga0126379_133964011 | 3300010366 | Tropical Forest Soil | MRGPLSPQAADLVRRIARVFPDEPGGLMAGIHAAVSAAA |
| Ga0136449_1009985184 | 3300010379 | Peatlands Soil | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEVHAAV |
| Ga0157344_10282691 | 3300012476 | Arabidopsis Rhizosphere | MAVVADAGEPLSPQAADLVRRVARVFLDEPADLMAELHA |
| Ga0164298_109979212 | 3300012955 | Soil | MAVVADAGEPLSAQAADLIRQIARVFLDEPADLMAEVHAAVSAAADE |
| Ga0126369_128342712 | 3300012971 | Tropical Forest Soil | MAVVHDAGEPLSPQAADLARRIARVFLDEPADLMDQVYTPSRPSSG |
| Ga0157371_114639891 | 3300013102 | Corn Rhizosphere | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAE |
| Ga0132258_114018201 | 3300015371 | Arabidopsis Rhizosphere | MAVMPDAGEPDAGKPLSPQAADLVRRIARTILDEPADLLDQVHAAVA |
| Ga0132255_1003138821 | 3300015374 | Arabidopsis Rhizosphere | MAVVPDAGESLSPEAADLVRRVARVFLDEPADLMAEV |
| Ga0182036_111187982 | 3300016270 | Soil | MRVVPEAGELLSPQAADLVRRIARGILDEPADLMDQVHAAV |
| Ga0182033_106738022 | 3300016319 | Soil | VADAGELLSPQAAELVRRIARMILDEPADLMDQVQA |
| Ga0182033_109458442 | 3300016319 | Soil | MAVVPDAGEPDATEPLSPQAADLVRRIARVILDEPADLMDQVHADVSAAADEPLRS |
| Ga0182035_103848721 | 3300016341 | Soil | MAVVPDAGEPLSPQAADLVRRIARAVLDEPADLMA |
| Ga0182040_104107291 | 3300016387 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQVQAAEEPLN |
| Ga0187806_10337243 | 3300017928 | Freshwater Sediment | MAVVADAGEPLSPQAADLTRRVARVFLDEPADLMAELHA |
| Ga0187825_104427732 | 3300017930 | Freshwater Sediment | MAVVADAGEPLSPQAADLIRRVARVVLDEPADLMAE |
| Ga0187776_111149983 | 3300017966 | Tropical Peatland | VPDAGEPDAGGILSPQAADLVRRIAGVVLGEPADLMAAVHAAVSAAAD |
| Ga0187804_101016081 | 3300018006 | Freshwater Sediment | MAVVADAGEPLSPQAADLIRRVARVFLDEPADLMA |
| Ga0210400_109479662 | 3300021170 | Soil | MAVVADAGEPLSPQAADLVRRVARVFLDEPADLMAE |
| Ga0210405_102886881 | 3300021171 | Soil | MTVVPDVGEPLSPQAADLVRRIARMVLDEPADLMTEVQAAVSAA |
| Ga0210396_103215293 | 3300021180 | Soil | MAVVPDAGEPLSPQAANLVRRIARMVLDEPTDLMAEVQAA |
| Ga0210389_103546013 | 3300021404 | Soil | MAVVPGAGELLSPQAADLVRRLARGILDEPADLMAEVYAAV |
| Ga0210386_116054811 | 3300021406 | Soil | MAVVADAGEPLSPQAADLIRRVARVFLDEPADLMAELH |
| Ga0210409_101087275 | 3300021559 | Soil | VADAGEPLSPQAADLVRRVARVFLDEPADLMAELHAAVLAAVD |
| Ga0126371_120563891 | 3300021560 | Tropical Forest Soil | MATVPDAGEPLSPQAADLVRRISRAVLDEPAELMAEVHAAV |
| Ga0207656_104026922 | 3300025321 | Corn Rhizosphere | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEAHA |
| Ga0207699_104354911 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVVADAGEPLSPQAADLVRRVARVFLDEPADLMAELHAA |
| Ga0207654_110690432 | 3300025911 | Corn Rhizosphere | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEAH |
| Ga0207693_101036114 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTVVPDAGESLSPQAADLVRRVAQRILDEPAELMD |
| Ga0207663_102653371 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVVPDAGESLSPEAADLVRRVARVFLDEPADLMAE |
| Ga0207662_103723141 | 3300025918 | Switchgrass Rhizosphere | MAVVPDAGEPLSPEAADLVRRVARVFLDEPADLMA |
| Ga0207662_111278532 | 3300025918 | Switchgrass Rhizosphere | MAVVPEAGEPLSPQAADLVRRLARTILDEPADLMDQVHAAVSAAA |
| Ga0207700_100390741 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDAAGPLSPQTADLVRRIARVVLDEPADLMDQVQAAVSAAADE |
| Ga0207700_103932181 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVVPDAGEPLSPQAADLIRRIARVFLDEPADLMAELHAAVSAAADE |
| Ga0207686_116959921 | 3300025934 | Miscanthus Rhizosphere | MAVVPEAGEPLSPQAADLVRRIARTVLDEPADLMDQV |
| Ga0207709_107672542 | 3300025935 | Miscanthus Rhizosphere | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEAHAAVSAAADEPLR |
| Ga0207689_100693887 | 3300025942 | Miscanthus Rhizosphere | MAVVPEAGEPLSPQAADLVRRIARTVLDEPADLMDQVHAAVSAA |
| Ga0257164_10672792 | 3300026497 | Soil | MTVVAGAGEPLSPQAADLVRRVARVFLDEPADLMAE |
| Ga0310038_100982241 | 3300030707 | Peatlands Soil | MAVVADAGEPLSPQAADLVRRVARVFLDEPADLMAEV |
| Ga0318516_102394712 | 3300031543 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQVHAAVSAAADEP |
| Ga0318541_106697132 | 3300031545 | Soil | VPDSGEQLSPQAADLARRIARVFLDEPADLMAEVHAAVSAAA |
| Ga0318573_106395981 | 3300031564 | Soil | MTVVPDAGEPLSPQAADLVRRIARVFLDEPADLMDQVQAAVS |
| Ga0318542_102147873 | 3300031668 | Soil | VADAGELDAGEPLSPQAADMVRRIARVILDEPADLMD |
| Ga0318572_100399071 | 3300031681 | Soil | VADAGEPDAGEPLSPQAADLVRRIARAILDEPADLMDQVHEAVSAAAC |
| Ga0318560_103598592 | 3300031682 | Soil | MAVVPDAGEPLSPQAADLVRRIARAVLDEPADLMAEVYAAE |
| Ga0318496_100712261 | 3300031713 | Soil | MAVVPDAGEPLSPQAADLVRRIARAVLDEPADLMAEVYAAVS |
| Ga0318496_105871982 | 3300031713 | Soil | VADAGELDAGEPLSPQAADMVRRIARVILDEPADLMDRV |
| Ga0318493_105021001 | 3300031723 | Soil | MAVVPDHGQPLSPQAADLVRRIARTVLDEPADLMTEVYAAVSAAA |
| Ga0318501_100065301 | 3300031736 | Soil | VPDAGEPLSPQAADLARRIARVILDEPADLMAEVHA |
| Ga0318501_100993311 | 3300031736 | Soil | MAIVPDAGEPLSPQAADLVRRIARVFLDEPADLMDQVQAAVSA |
| Ga0318502_105485472 | 3300031747 | Soil | MAVMPDAGEPDAGKLLSPQAADLVRRIARTILDDPDDLMDQVHAA |
| Ga0318494_103983931 | 3300031751 | Soil | LSPQAADLIRRIARVFLDEPGELMAEVQAAVSAAAD |
| Ga0318494_106669921 | 3300031751 | Soil | VPDSGEQLSPQAADLARRIARVFLDEPADLMAEVHAAVSAAADEPLR |
| Ga0318535_101546481 | 3300031764 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQV |
| Ga0318535_104386702 | 3300031764 | Soil | MAIVPDAGEPLSPQAADLVRRIARVFLDEPADLMDQVQ |
| Ga0318554_105652583 | 3300031765 | Soil | VSDAGEPDAAEPLSPQAAGLVRRIARAVLDEPADLMAEVYA |
| Ga0318554_108383032 | 3300031765 | Soil | LSPQAADLVRRVAQVFLDEPADLMDQVQAAVSAAADEPL |
| Ga0318526_100721041 | 3300031769 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQ |
| Ga0318521_110448232 | 3300031770 | Soil | MAVVPDVGELLSPQAADLVRRIARMVLDEPADLMDQVQAAVSAAADEPL |
| Ga0318546_109035181 | 3300031771 | Soil | MAVVPDAGEALSPQAAELVRRIARRILDEPADLMAEIYAAVSAA |
| Ga0318566_100703184 | 3300031779 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQVHAAVSAAADEPL |
| Ga0318552_103604802 | 3300031782 | Soil | MAVVPDAGEPLSPQAADLVRRIARAVLDEPADLMAEV |
| Ga0318548_101043033 | 3300031793 | Soil | VADAGEPDAGEPLSPQAADLVRRIARAILDEPADLMDQVHEAVSAAACGD |
| Ga0318576_100564411 | 3300031796 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQVHAAVSA |
| Ga0318576_101791231 | 3300031796 | Soil | VPDSGKQLSPQAADLARRIARVFLDEPADLMAEVHAAVSAAADEP |
| Ga0318576_104718412 | 3300031796 | Soil | MAAVPDAGKPLSPQAADLVRRIARAVLDEPADLMAEVYAAVSA |
| Ga0318565_103419142 | 3300031799 | Soil | VPDSGKQLSPQAADLARRIARVFLDEPADLMAEVHAAV |
| Ga0318497_106320312 | 3300031805 | Soil | MAVVPDAGEPLSPQAADLVRRIARGILDEPADLMD |
| Ga0318497_106445492 | 3300031805 | Soil | MAVVPDNGQPLSPQAADLVRRIARVFLDEPADLMAEMYAAVS |
| Ga0318511_100784683 | 3300031845 | Soil | VADAGEPDAGEPLSPQAADLVRRIARAILDEPADLMDQV |
| Ga0318512_100942423 | 3300031846 | Soil | VADAGEPDAGEPLSPQAADLVRRIARAILDEPADLMDQVH |
| Ga0318495_100109121 | 3300031860 | Soil | VPDAGEPLSPQAAELVRRIARVFLDEPADLMDQVHSAV |
| Ga0306925_117133571 | 3300031890 | Soil | MAVVPDAGEALSPQAAELVRRIARRILDEPADLMAEIHAAVS |
| Ga0318551_104242281 | 3300031896 | Soil | MAIVPDAGEPLSPQAADLVRRIARVFLDEPADLMDQVQAAVSAAADEP |
| Ga0318551_109530702 | 3300031896 | Soil | MAVVTHAGEPLSPQAADLVRRIARVILDEPADLMAEVQAAVSAAAMSRCAPSRCWPRR |
| Ga0318520_110928031 | 3300031897 | Soil | MAVVPDAAEPLSPQAADLVRRIARVILDEPAGLMDQVQAAVT |
| Ga0306923_108337753 | 3300031910 | Soil | VADAGEPDAGEPLSPQAADLVRRIARAILDEPADLMDQVHEAVSAAAD |
| Ga0306921_109054391 | 3300031912 | Soil | VADAGEPDAGEPLSPQAADLVRRIARGILDQPAGLMSQV |
| Ga0306921_115619662 | 3300031912 | Soil | MAVVPDNGQPLSPQAADLVRRIARVFLDEPADLMAEMYAAVSAAADEP |
| Ga0308175_1006140011 | 3300031938 | Soil | MTVVPEAGEPLSPQAADLVRRIARTILDEPDDLLDQVHAAVSAAA |
| Ga0306922_109181212 | 3300032001 | Soil | MAVVPDHGQPLSPQAADLVRRIARTVLDEPADLMTEVYAAVSAAADEP |
| Ga0318563_101684492 | 3300032009 | Soil | MAVVPDAGEPLSPQAADLVRRIARGILDEPADLMDQVHAAVSAACT |
| Ga0318569_101395971 | 3300032010 | Soil | MAVVPDHGQPLSPQAADLVRRIARTVLDEPADLMTE |
| Ga0318569_102060143 | 3300032010 | Soil | VADAGEPDAGEPLSPQAADLVRRIARGILDEPADLMDRV |
| Ga0318569_103586031 | 3300032010 | Soil | VPDAGEPLSPQAAELVRRIARVFLDEPADLMAEMHA |
| Ga0318559_101262782 | 3300032039 | Soil | MRVVPEAGEPLSPQAADLVRRIARGILDEPADLMDQVH |
| Ga0318558_100888401 | 3300032044 | Soil | VPDAGEPLSPQAAELVRRIARVFLDEPADLMAEMHAAVSAAADEPL |
| Ga0318506_101515421 | 3300032052 | Soil | VPDAGESLSPQAAELARRIARVFLDEPADLMAEVHAA |
| Ga0318570_103060952 | 3300032054 | Soil | MTVVPDAGEPLSPQAADLVRRIARVFLDEPADLMDQVQA |
| Ga0318575_101773321 | 3300032055 | Soil | MAVMPDAGEPLSPQAADLVRQVAQAVLDEPADLMAEVYAAVSAAADEPLR |
| Ga0318504_101621213 | 3300032063 | Soil | MAVVPDAGEPLSPQAADLVRRIARGILDEPADLMDQVHAAVSAAC |
| Ga0318513_103678302 | 3300032065 | Soil | MAVVPDNGQPLSPQAADLVRRIARVFLDEPADLMAEMYA |
| Ga0318514_103619321 | 3300032066 | Soil | MTVMPDAGEPLSPQAADLVRQVAQVVLDEPADLMAEVYAAVS |
| Ga0318525_102684471 | 3300032089 | Soil | MTVMPDAGEPLSPQAADLIRQIAQMVLDEPADLMA |
| Ga0318518_103481762 | 3300032090 | Soil | MAVVPDAGEPLSPQAADLVRRIARAVLDEPADLMAEVYAAVSA |
| Ga0311301_107229061 | 3300032160 | Peatlands Soil | MAVVPDAGEPLSPQAADLVRRVARVFLDEPADLMAEVHAAVSAAAD |
| Ga0307472_1019800401 | 3300032205 | Hardwood Forest Soil | VPDAGEPLSPQAADLVRRIARVFLDEPADLMAELHAAVLA |
| Ga0335070_104482943 | 3300032829 | Soil | VPDAGEPDAREPLSPQAADLVRRIARVILDEPADFM |
| ⦗Top⦘ |