Metagenome / Metatranscriptome Family F088365

Select file to download:
Download

Basic Information
Family ID	F088365
Family Type	Metagenome / Metatranscriptome
Number of Sequences	109
Average Sequence Length	179 residues
Representative Sequence	YVTSPMLAPCTVTDADPVPARFCRRIMLNAPASTDHPCVTLPPRSPTVIVTRRVPRAPCVTRHLTDVSDSHCVASHPVCPSRARPVYVTSPMLAPCTVTDADPVPARFCRRIMLNAPASTDHPCVTLPLRSPTVIVTRRVPRAPCVTRHLTDVSDSHCVASHPVCPS
Number of Associated Samples	74
Number of Associated Scaffolds	108

Basic Information

Family ID

F088365

Family Type

Metagenome / Metatranscriptome

Number of Sequences

109

Average Sequence Length

179 residues

Representative Sequence

YVTSPMLAPCTVTDADPVPARFCRRIMLNAPASTDHPCVTLPPRSPTVIVTRRVPRAPCVTRHLTDVSDSHCVASHPVCPSRARPVYVTSPMLAPCTVTDADPVPARFCRRIMLNAPASTDHPCVTLPLRSPTVIVTRRVPRAPCVTRHLTDVSDSHCVASHPVCPS

Number of Associated Samples

Number of Associated Scaffolds

108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	7.14 %
% of genes near scaffold ends (potentially truncated)	86.24 %
% of genes from short scaffolds (< 2000 bps)	87.16 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.20

Quality Assessment

Transcriptomic Evidence

Yes

Most common taxonomic group

Eukaryota

% of genes with valid RBS motifs

7.14 %

% of genes near scaffold ends (potentially truncated)

86.24 %

% of genes from short scaffolds (< 2000 bps)

87.16 %

Associated GOLD sequencing projects

AlphaFold2 3D model prediction

Yes

3D model pTM-score

0.20

Hidden Markov Model

Powered by Skylign

Most Common Taxonomy
Group	Eukaryota (86.239 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Taxonomy

Group

Eukaryota (86.239 % of family members)

NCBI Taxonomy ID

2759

Taxonomy

All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (26.605 % of family members)
Environment Ontology (ENVO)	Unclassified (36.697 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (46.789 % of family members)

Most Common Ecosystem

GOLD Ecosystem

Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater
(26.605 % of family members)

Environment Ontology (ENVO)

Unclassified
(36.697 % of family members)

Earth Microbiome Project Ontology (EMPO)

Free-living → Non-saline → Water (non-saline)
(46.789 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 18.46% Coil/Unstructured: 81.54%
Feature Viewer

Powered by Feature Viewer

Predicted Topology & Secondary Structure

Classification:

Fibrous

Signal Peptide:

Secondary Structure distribution:

α-helix: 0.00% β-sheet: 18.46% Coil/Unstructured: 81.54%

Feature Viewer

Powered by Feature Viewer

Structure Viewer

Per-residue confidence (pLDDT):
0-50 51-70 71-90 91-100

pTM-score: 0.20

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.99 %
Unclassified	root	N/A	11.01 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.16 %
Unclassified	root	N/A	11.01 %
Viruses	superkingdom	All Organisms → Viruses	1.83 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	86.24 %
Unclassified	root	N/A	11.01 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptophyceae	class	All Organisms → cellular organisms → Eukaryota → Cryptophyceae	86.24 %
Unclassified	root	N/A	11.01 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonadales	order	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales	80.73 %
Unclassified	root	N/A	11.01 %
Pyrenomonadales	order	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonadaceae	family	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae	80.73 %
Unclassified	root	N/A	11.01 %
Geminigeraceae	family	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonas	genus	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas	80.73 %
Unclassified	root	N/A	11.01 %
Guillardia	genus	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonas curvata	species	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	80.73 %
Unclassified	root	N/A	11.01 %
Guillardia theta	species	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonas curvata	species	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	80.73 %
Unclassified	root	N/A	11.01 %
Guillardia theta CCMP2712	strain	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonas curvata	species	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	80.73 %
Unclassified	root	N/A	11.01 %
Guillardia theta CCMP2712	strain	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
unclassified Mycobacterium	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium	0.92 %

Name	Rank	Taxonomy	Distribution
Cryptomonas curvata	species	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	80.73 %
Unclassified	root	N/A	11.01 %
Guillardia theta CCMP2712	strain	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	5.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Mycobacterium sp. URHB0044	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. URHB0044	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300006917\|Ga0075472_10661563	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. URHB0044	525	Open in IMG/M
3300006917\|Ga0075472_10679342	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	518	Open in IMG/M
3300007236\|Ga0075463_10250940	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	569	Open in IMG/M
3300007516\|Ga0105050_10726507	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	571	Open in IMG/M
3300007519\|Ga0105055_11086868	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	570	Open in IMG/M
3300007519\|Ga0105055_11269527	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	511	Open in IMG/M
3300007519\|Ga0105055_11288568	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	506	Open in IMG/M
3300007520\|Ga0105054_10315654	All Organisms → Viruses → Predicted Viral	1400	Open in IMG/M
3300007520\|Ga0105054_10877271	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	640	Open in IMG/M
3300007520\|Ga0105054_11000510	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	581	Open in IMG/M
3300007520\|Ga0105054_11064282	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	556	Open in IMG/M
3300007520\|Ga0105054_11152330	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	525	Open in IMG/M
3300007522\|Ga0105053_10579782	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	885	Open in IMG/M
3300007522\|Ga0105053_11123968	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	537	Open in IMG/M
3300007522\|Ga0105053_11149104	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	529	Open in IMG/M
3300007523\|Ga0105052_10866654	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	565	Open in IMG/M
3300007523\|Ga0105052_11000966	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	519	Open in IMG/M
3300007623\|Ga0102948_1287307	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	503	Open in IMG/M
3300007722\|Ga0105051_11231510	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	530	Open in IMG/M
3300007722\|Ga0105051_11264129	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	522	Open in IMG/M
3300007722\|Ga0105051_11287826	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	517	Open in IMG/M
3300007955\|Ga0105740_1104150	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	504	Open in IMG/M
3300008259\|Ga0114841_1031352	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	2719	Open in IMG/M
3300008259\|Ga0114841_1031352	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	2719	Open in IMG/M
3300009151\|Ga0114962_10697381	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	519	Open in IMG/M
3300009185\|Ga0114971_10604853	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	606	Open in IMG/M
3300009436\|Ga0115008_11525999	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	517	Open in IMG/M
3300009790\|Ga0115012_11893235	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	525	Open in IMG/M
3300010158\|Ga0114960_10604723	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	519	Open in IMG/M
3300010334\|Ga0136644_10705583	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	548	Open in IMG/M
3300010354\|Ga0129333_10730882	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	849	Open in IMG/M
3300012037\|Ga0136559_1214961	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	539	Open in IMG/M
3300012418\|Ga0138261_1828127	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	504	Open in IMG/M
3300012959\|Ga0157620_1079901	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	540	Open in IMG/M
3300013005\|Ga0164292_10911639	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	551	Open in IMG/M
3300013014\|Ga0164295_11329787	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	558	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10781291	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	594	Open in IMG/M
3300017709\|Ga0181387_1136190	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	507	Open in IMG/M
3300017957\|Ga0181571_10906358	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	519	Open in IMG/M
3300018415\|Ga0181559_10646424	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	569	Open in IMG/M
3300018428\|Ga0181568_11333454	Not Available	535	Open in IMG/M
3300018428\|Ga0181568_11486057	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	500	Open in IMG/M
3300020141\|Ga0211732_1581982	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	526	Open in IMG/M
3300020198\|Ga0194120_10497817	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	550	Open in IMG/M
3300021317\|Ga0210309_1033611	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	588	Open in IMG/M
3300021364\|Ga0213859_10524648	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	512	Open in IMG/M
3300021375\|Ga0213869_10443182	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	523	Open in IMG/M
3300025879\|Ga0209555_10397111	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	505	Open in IMG/M
3300027746\|Ga0209597_1359987	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	541	Open in IMG/M
3300027806\|Ga0209985_10442796	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	555	Open in IMG/M
3300027832\|Ga0209491_10278027	All Organisms → Viruses → Predicted Viral	1325	Open in IMG/M
3300027832\|Ga0209491_10523884	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	762	Open in IMG/M
3300027832\|Ga0209491_10609779	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	660	Open in IMG/M
3300027832\|Ga0209491_10620250	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	649	Open in IMG/M
3300027832\|Ga0209491_10759310	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	533	Open in IMG/M
3300027836\|Ga0209230_10437652	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	746	Open in IMG/M
3300027836\|Ga0209230_10803682	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	510	Open in IMG/M
3300027848\|Ga0209390_10819077	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	506	Open in IMG/M
3300027974\|Ga0209299_1331125	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	524	Open in IMG/M
3300027983\|Ga0209284_10601611	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	514	Open in IMG/M
3300028266\|Ga0255227_1057766	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	600	Open in IMG/M
3300028373\|Ga0306897_1097961	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	510	Open in IMG/M
(restricted) 3300028559\|Ga0247831_1233746	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	655	Open in IMG/M
3300031737\|Ga0307387_11002435	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	533	Open in IMG/M
3300031758\|Ga0315907_10144020	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	2023	Open in IMG/M
3300031784\|Ga0315899_11466721	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	573	Open in IMG/M
3300031784\|Ga0315899_11724169	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	513	Open in IMG/M
3300031784\|Ga0315899_11774997	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	503	Open in IMG/M
3300031784\|Ga0315899_11786666	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	501	Open in IMG/M
3300031786\|Ga0315908_11155661	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	616	Open in IMG/M
3300031786\|Ga0315908_11164674	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	613	Open in IMG/M
3300031786\|Ga0315908_11299694	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	573	Open in IMG/M
3300031786\|Ga0315908_11559395	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	513	Open in IMG/M
3300032047\|Ga0315330_10886139	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	505	Open in IMG/M
3300032092\|Ga0315905_10767412	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	844	Open in IMG/M
3300032092\|Ga0315905_10810263	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	813	Open in IMG/M
3300032092\|Ga0315905_11285038	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	590	Open in IMG/M
3300032092\|Ga0315905_11368078	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	565	Open in IMG/M
3300032092\|Ga0315905_11565139	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	513	Open in IMG/M
3300032462\|Ga0335396_10649185	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712	652	Open in IMG/M
3300032462\|Ga0335396_10728522	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	604	Open in IMG/M
3300032462\|Ga0335396_10852339	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	543	Open in IMG/M
3300032462\|Ga0335396_10941794	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	507	Open in IMG/M
3300033978\|Ga0334977_0562469	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	513	Open in IMG/M
3300033979\|Ga0334978_0565500	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	525	Open in IMG/M
3300033984\|Ga0334989_0545667	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	566	Open in IMG/M
3300034060\|Ga0334983_0762738	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	508	Open in IMG/M
3300034066\|Ga0335019_0664432	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	602	Open in IMG/M
3300034094\|Ga0335014_0516581	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	502	Open in IMG/M
3300034109\|Ga0335051_0539314	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	538	Open in IMG/M
3300034112\|Ga0335066_0492522	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	651	Open in IMG/M
3300034116\|Ga0335068_0550593	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	526	Open in IMG/M
3300034121\|Ga0335058_0477973	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	708	Open in IMG/M
3300034121\|Ga0335058_0666022	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	577	Open in IMG/M
3300034122\|Ga0335060_0591025	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	559	Open in IMG/M
3300034167\|Ga0335017_0579955	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	583	Open in IMG/M
3300034284\|Ga0335013_0583657	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	655	Open in IMG/M
3300034357\|Ga0335064_0857676	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata	550	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat

Taxonomy

Distribution

Environmental

100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat

Taxonomy

Distribution

Aquatic

Environmental → Aquatic

100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	77.98%
Marine	Environmental → Aquatic → Marine	19.27%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	2.75%

Habitat

Taxonomy

Distribution

Freshwater

Environmental → Aquatic → Freshwater

77.98%

Marine

Environmental → Aquatic → Marine

19.27%

Non-Marine Saline And Alkaline

Environmental → Aquatic → Non-Marine Saline And Alkaline

2.75%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	33.95%
Ice	Environmental → Aquatic → Freshwater → Ice	26.61%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	13.76%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	7.34%
Coastal	Environmental → Aquatic → Marine → Coastal	6.42%
Oceanic	Environmental → Aquatic → Marine → Oceanic	3.67%
Lentic	Environmental → Aquatic → Freshwater → Lentic	2.75%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	2.75%
River	Environmental → Aquatic → Freshwater → River	0.92%
Unclassified	Environmental → Aquatic → Marine → Unclassified	0.92%
Strait	Environmental → Aquatic → Marine → Strait	0.92%

Habitat

Taxonomy

Distribution

Lake

Environmental → Aquatic → Freshwater → Lake

33.95%

Ice

Environmental → Aquatic → Freshwater → Ice

26.61%

Unclassified

Environmental → Aquatic → Freshwater → Unclassified

13.76%

Intertidal Zone

Environmental → Aquatic → Marine → Intertidal Zone

7.34%

Coastal

Environmental → Aquatic → Marine → Coastal

6.42%

Oceanic

Environmental → Aquatic → Marine → Oceanic

3.67%

Lentic

Environmental → Aquatic → Freshwater → Lentic

2.75%

Saline

Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline

2.75%

River

Environmental → Aquatic → Freshwater → River

0.92%

Unclassified

Environmental → Aquatic → Marine → Unclassified

0.92%

Strait

Environmental → Aquatic → Marine → Strait

0.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	33.95%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	26.61%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	13.76%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	6.42%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	3.67%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	3.67%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	2.75%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	2.75%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	1.83%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.83%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.92%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	0.92%
Unclassified	Environmental → Aquatic → Marine → Strait → Unclassified	0.92%

Habitat

Taxonomy

Distribution

Unclassified

Environmental → Aquatic → Freshwater → Lake → Unclassified

33.95%

Glacial Lake

Environmental → Aquatic → Freshwater → Ice → Glacial Lake

26.61%

Unclassified

Environmental → Aquatic → Freshwater → Unclassified → Unclassified

13.76%

Unclassified

Environmental → Aquatic → Marine → Coastal → Unclassified

6.42%

Unclassified

Environmental → Aquatic → Marine → Oceanic → Unclassified

3.67%

Salt Marsh

Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh

3.67%

Unclassified

Environmental → Aquatic → Freshwater → Lentic → Unclassified

2.75%

Unclassified

Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified

2.75%

Unclassified

Environmental → Aquatic → Marine → Intertidal Zone → Unclassified

1.83%

Estuary

Environmental → Aquatic → Marine → Intertidal Zone → Estuary

1.83%

Unclassified

Environmental → Aquatic → Freshwater → River → Unclassified

0.92%

Unclassified

Environmental → Aquatic → Marine → Unclassified → Unclassified

0.92%

Unclassified

Environmental → Aquatic → Marine → Strait → Unclassified

0.92%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	26.61%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	23.85%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	13.76%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.42%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	3.67%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	2.75%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	2.75%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.83%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.83%
Seawater	Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater	1.83%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.83%
Saline Lake	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake	1.83%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.92%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.92%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.92%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.92%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	0.92%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.92%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.92%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.92%
Seawater	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater	0.92%
Seawater	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater	0.92%
Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water	0.92%
Polar Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine	0.92%

Habitat

Taxonomy

Distribution

Freshwater

Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater

26.61%

Freshwater

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater

23.85%

Freshwater

Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater

13.76%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake

6.42%

Salt Marsh

Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh

3.67%

Marine

Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine

2.75%

Aqueous

Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous

2.75%

Freshwater And Sediment

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment

1.83%

Freshwater, Plankton

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton

1.83%

Seawater

Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater

1.83%

Estuarine

Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine

1.83%

Saline Lake

Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake

1.83%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake

0.92%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake

0.92%

Freshwater

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater

0.92%

Freshwater

Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater

0.92%

Seawater

Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater

0.92%

Freshwater To Marine Saline Gradient

Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient

0.92%

Estuary Water

Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water

0.92%

Marine

Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine

0.92%

Seawater

Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater

0.92%

Seawater

Environmental → Aquatic → Marine → Strait → Unclassified → Seawater

0.92%

Water

Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water

0.92%

Polar Marine

Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine

0.92%

Visualization

Powered by ApexCharts

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300007236	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA	Environmental	Open in IMG/M
3300007516	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01	Environmental	Open in IMG/M
3300007519	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03	Environmental	Open in IMG/M
3300007520	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)	Environmental	Open in IMG/M
3300007522	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01	Environmental	Open in IMG/M
3300007523	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03	Environmental	Open in IMG/M
3300007623	Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG	Environmental	Open in IMG/M
3300007722	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)	Environmental	Open in IMG/M
3300007955	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0um	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300009080	Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental	Open in IMG/M
3300009436	Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome	Environmental	Open in IMG/M
3300009790	Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300012037	Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #496	Environmental	Open in IMG/M
3300012418	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012737	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES003 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012952	Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome	Environmental	Open in IMG/M
3300012959	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013014	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300017709	Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27	Environmental	Open in IMG/M
3300017957	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)	Environmental	Open in IMG/M
3300018415	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)	Environmental	Open in IMG/M
3300018428	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020198	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m	Environmental	Open in IMG/M
3300021317	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021364	Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304	Environmental	Open in IMG/M
3300021375	Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132	Environmental	Open in IMG/M
3300025879	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027806	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)	Environmental	Open in IMG/M
3300027832	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027848	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)	Environmental	Open in IMG/M
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027983	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)	Environmental	Open in IMG/M
3300028266	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028373	Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563 (v2)	Environmental	Open in IMG/M
3300028559 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m	Environmental	Open in IMG/M
3300031737	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300032047	Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032462	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental	Open in IMG/M
3300034021	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057	Environmental	Open in IMG/M
3300034060	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034094	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034109	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M
3300034122	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181	Environmental	Open in IMG/M
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M
3300034357	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187	Environmental	Open in IMG/M

Taxon OID

Sample Name

Habitat Type

IMG/M Link

3300006917

Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA

Environmental

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.20
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.20
Powered by PDBe Molstar

Geographical Distribution

Zoom:	Powered by OpenStreetMap