NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088361

Metagenome Family F088361

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088361
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 36 residues
Representative Sequence VKVPFQGSREEENGLMESKKPKGKTYNRNNINQEE
Number of Associated Samples 7
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 11.93 %
% of genes near scaffold ends (potentially truncated) 5.50 %
% of genes from short scaffolds (< 2000 bps) 32.11 %
Associated GOLD sequencing projects 5
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (63.303 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules
(54.128 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.76%    β-sheet: 0.00%    Coil/Unstructured: 95.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00078RVT_1 8.49
PF03732Retrotrans_gag 4.72
PF00067p450 3.77
PF07727RVT_2 1.89
PF14223Retrotran_gag_2 1.89
PF03108DBD_Tnp_Mut 0.94
PF10551MULE 0.94
PF08284RVP_2 0.94
PF13456RVT_3 0.94
PF13650Asp_protease_2 0.94
PF15072HROB 0.94
PF00665rve 0.94
PF04434SWIM 0.94
PF01585G-patch 0.94
PF00098zf-CCHC 0.94
PF03168LEA_2 0.94
PF00332Glyco_hydro_17 0.94
PF14372DUF4413 0.94
PF05970PIF1 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 3.77
COG0507ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.94
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.94
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.94
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.94
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.94
COG4584TransposaseMobilome: prophages, transposons [X] 0.94
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.94
COG5309Exo-beta-1,3-glucanase, GH17 familyCarbohydrate transport and metabolism [G] 0.94
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.50 %
UnclassifiedrootN/A5.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006943|Ga0099822_1005275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16887Open in IMG/M
3300006943|Ga0099822_1005275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16887Open in IMG/M
3300006943|Ga0099822_1008461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta13148Open in IMG/M
3300006943|Ga0099822_1009184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna12515Open in IMG/M
3300006943|Ga0099822_1009741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12034Open in IMG/M
3300006943|Ga0099822_1010735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11310Open in IMG/M
3300006943|Ga0099822_1011811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10578Open in IMG/M
3300006943|Ga0099822_1015056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8755Open in IMG/M
3300006943|Ga0099822_1016993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae7876Open in IMG/M
3300006943|Ga0099822_1017319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7722Open in IMG/M
3300006943|Ga0099822_1017671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7582Open in IMG/M
3300006943|Ga0099822_1018130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae7386Open in IMG/M
3300006943|Ga0099822_1019561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6872Open in IMG/M
3300006943|Ga0099822_1022358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5980Open in IMG/M
3300006943|Ga0099822_1024943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5281Open in IMG/M
3300006943|Ga0099822_1032375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3725Open in IMG/M
3300006943|Ga0099822_1032379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae3724Open in IMG/M
3300006943|Ga0099822_1032728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3665Open in IMG/M
3300006943|Ga0099822_1033230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis3582Open in IMG/M
3300006943|Ga0099822_1034445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3382Open in IMG/M
3300006943|Ga0099822_1038546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2815Open in IMG/M
3300006943|Ga0099822_1040001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis2643Open in IMG/M
3300006943|Ga0099822_1041060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis2520Open in IMG/M
3300006943|Ga0099822_1045083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2140Open in IMG/M
3300006943|Ga0099822_1045612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2095Open in IMG/M
3300006943|Ga0099822_1047526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1948Open in IMG/M
3300006943|Ga0099822_1047717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1934Open in IMG/M
3300006943|Ga0099822_1055140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1486Open in IMG/M
3300006943|Ga0099822_1058459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1343Open in IMG/M
3300006943|Ga0099822_1067620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1050Open in IMG/M
3300006943|Ga0099822_1068759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1022Open in IMG/M
3300006943|Ga0099822_1071613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis959Open in IMG/M
3300006943|Ga0099822_1078321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis838Open in IMG/M
3300006943|Ga0099822_1083230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis766Open in IMG/M
3300006943|Ga0099822_1083389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis764Open in IMG/M
3300006943|Ga0099822_1084131Not Available754Open in IMG/M
3300006943|Ga0099822_1101553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis591Open in IMG/M
3300006943|Ga0099822_1111539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis530Open in IMG/M
3300006943|Ga0099822_1116890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis504Open in IMG/M
3300006944|Ga0099823_1035177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max3924Open in IMG/M
3300006944|Ga0099823_1064397Not Available1801Open in IMG/M
3300006944|Ga0099823_1091924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1022Open in IMG/M
3300006944|Ga0099823_1104698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta833Open in IMG/M
3300021320|Ga0214544_1000103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta115169Open in IMG/M
3300021320|Ga0214544_1000776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae61649Open in IMG/M
3300021320|Ga0214544_1001177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata52992Open in IMG/M
3300021320|Ga0214544_1001849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae44588Open in IMG/M
3300021320|Ga0214544_1001849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae44588Open in IMG/M
3300021320|Ga0214544_1002728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata36913Open in IMG/M
3300021320|Ga0214544_1002804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida36447Open in IMG/M
3300021320|Ga0214544_1004226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata28987Open in IMG/M
3300021320|Ga0214544_1004382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata28433Open in IMG/M
3300021320|Ga0214544_1004385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta28416Open in IMG/M
3300021320|Ga0214544_1005357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24901Open in IMG/M
3300021320|Ga0214544_1005591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24162Open in IMG/M
3300021320|Ga0214544_1005988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae22942Open in IMG/M
3300021320|Ga0214544_1007154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata19865Open in IMG/M
3300021320|Ga0214544_1008289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida17416Open in IMG/M
3300021320|Ga0214544_1008378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17241Open in IMG/M
3300021320|Ga0214544_1008378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17241Open in IMG/M
3300021320|Ga0214544_1008388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17220Open in IMG/M
3300021320|Ga0214544_1008724Not Available16561Open in IMG/M
3300021320|Ga0214544_1009379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15395Open in IMG/M
3300021320|Ga0214544_1009691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna14848Open in IMG/M
3300021320|Ga0214544_1010182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14046Open in IMG/M
3300021320|Ga0214544_1010294All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13878Open in IMG/M
3300021320|Ga0214544_1010554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13491Open in IMG/M
3300021320|Ga0214544_1011353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12363Open in IMG/M
3300021320|Ga0214544_1012402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae11119Open in IMG/M
3300021320|Ga0214544_1012861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10586Open in IMG/M
3300021320|Ga0214544_1013086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10319Open in IMG/M
3300021320|Ga0214544_1013305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Phaseolus → Phaseolus vulgaris10063Open in IMG/M
3300021320|Ga0214544_1014296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae8995Open in IMG/M
3300021320|Ga0214544_1014541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8746Open in IMG/M
3300021320|Ga0214544_1015206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta8152Open in IMG/M
3300021320|Ga0214544_1015335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8044Open in IMG/M
3300021320|Ga0214544_1015854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7612Open in IMG/M
3300021320|Ga0214544_1016490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7103Open in IMG/M
3300021320|Ga0214544_1018077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6014Open in IMG/M
3300021320|Ga0214544_1020348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4736Open in IMG/M
3300021320|Ga0214544_1020575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4640Open in IMG/M
3300021320|Ga0214544_1021873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4040Open in IMG/M
3300021320|Ga0214544_1022680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3716Open in IMG/M
3300021320|Ga0214544_1022935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max3617Open in IMG/M
3300021320|Ga0214544_1023610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3390Open in IMG/M
3300021320|Ga0214544_1026905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis2481Open in IMG/M
3300021320|Ga0214544_1034971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1376Open in IMG/M
3300021320|Ga0214544_1038133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1154Open in IMG/M
3300021320|Ga0214544_1039267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1091Open in IMG/M
3300021320|Ga0214544_1040390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1030Open in IMG/M
3300021320|Ga0214544_1041940Not Available956Open in IMG/M
3300021320|Ga0214544_1042601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis928Open in IMG/M
3300021320|Ga0214544_1044291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis866Open in IMG/M
3300021320|Ga0214544_1045877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis810Open in IMG/M
3300021320|Ga0214544_1061180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis509Open in IMG/M
3300021321|Ga0214542_1003523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta31843Open in IMG/M
3300021321|Ga0214542_1016103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae7424Open in IMG/M
3300021321|Ga0214542_1024208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3445Open in IMG/M
3300021324|Ga0214545_1026288Not Available3188Open in IMG/M
3300021324|Ga0214545_1035127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1679Open in IMG/M
3300021324|Ga0214545_1062809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis571Open in IMG/M
3300021324|Ga0214545_1064180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis552Open in IMG/M
3300027296|Ga0209389_1030265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4572Open in IMG/M
3300027296|Ga0209389_1110155Not Available887Open in IMG/M
3300027296|Ga0209389_1121074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis724Open in IMG/M
3300027296|Ga0209389_1122739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis703Open in IMG/M
3300027357|Ga0209589_1043417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1378Open in IMG/M
3300027357|Ga0209589_1045068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1275Open in IMG/M
3300027357|Ga0209589_1054176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis892Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules54.13%
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules45.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006943Root nodule microbial communities of legume samples collected from California USA - Cow pea white BWHost-AssociatedOpen in IMG/M
3300006944Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BWHost-AssociatedOpen in IMG/M
3300021320Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3Host-AssociatedOpen in IMG/M
3300021321Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1Host-AssociatedOpen in IMG/M
3300021324Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4Host-AssociatedOpen in IMG/M
3300027296Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)Host-AssociatedOpen in IMG/M
3300027357Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099822_1005275153300006943Root NodulesMKVPFQGSKEEENGLMESKKPKGKTYNRNNINQKE*
Ga0099822_1005275183300006943Root NodulesMKVPFQGSKEEENGLMESKKPKGKTYNRNNINQEE*
Ga0099822_1008461213300006943Root NodulesVKVPFQGFREEENGLMKSMKPKGKTYNRNNINQEE*
Ga0099822_100918423300006943Root NodulesVKVPFQGSREEENGLMESNKPKGKTYNRNNINQEE*
Ga0099822_100974113300006943Root NodulesVKVPFQGSREDEDGLIESKKPKGKTYNRNNINQEE*
Ga0099822_1010735193300006943Root NodulesVKVPFQGSREDRNGLIVIEKPKGKTFKRERNREE*
Ga0099822_1011811163300006943Root NodulesMIASYLDVKVPFQCSREEENGLMESKKPKGKTYTRNNINREE*
Ga0099822_1015056163300006943Root NodulesVKVPFEGSNEEENGLMESKKPKGKTYNRNNINQEE*
Ga0099822_101699313300006943Root NodulesVKVPFQGSREEEDGLIESKKPKGKTYNRNNINQEE*
Ga0099822_1017319163300006943Root NodulesVRVPFQGSREEENGLMGSKKSKGKTYNRNNINQEE*
Ga0099822_101767113300006943Root NodulesMKVPFQGSREEENGLMESRKSKGKTYNRNNINQEE*
Ga0099822_1018130133300006943Root NodulesLKVPFQGSREEEHGLIESKKPKGKTYNRNNINQEE*
Ga0099822_1019561103300006943Root NodulesVKVPFQGSTEEEDGLIESKKPKGKTYNRNNINQEE*
Ga0099822_102235823300006943Root NodulesVKVSFQGSREEEDGLIESKKPKGKTYNRNNINQEEQRDIK*
Ga0099822_102494333300006943Root NodulesVKVPFQGSREEKNGLMEIKKPKEKTYNREKRNREE*
Ga0099822_103237533300006943Root NodulesVKVPFEGSREEEDGLMESKKPKGKTYNSNNINQEE*
Ga0099822_103237923300006943Root NodulesVKVPFQGSREEENGLMESKKPQGKTYNRNNINQEE*
Ga0099822_103272823300006943Root NodulesVKVAFQGYREEEDGLIESMKPKGKTYNRNNINQEE*
Ga0099822_103323013300006943Root NodulesVTVPFQGSREEEDGLIESKKPKGKTYNRNNINQED*
Ga0099822_103444523300006943Root NodulesVKVPFQGSREEKNGLMESKKPNGKTYNRNNINREE*
Ga0099822_103854633300006943Root NodulesLDIKIASNLDVKVPFQRSREEDNGLMESKKPKGKTYNRNNINQ*
Ga0099822_104000113300006943Root NodulesMKVPFQGSREEEDGLIESKKPKGKTYNKKNINQEE*
Ga0099822_104106013300006943Root NodulesVKVPFQGSREDENGLMGSKKSKGKTYNRNNINQEE*
Ga0099822_104508343300006943Root NodulesVKVPFQGSKEEENELMENKKPKGKTYNRNNINQEE*
Ga0099822_104561223300006943Root NodulesVKVPFQGSKEDEDGLIESKKPKGKTYNRNNINQEE*
Ga0099822_104752653300006943Root NodulesMIASYLDVKVPFQGSREEEDGLMENKKPKGKSYNRKNINQEE*
Ga0099822_104771713300006943Root NodulesMKVPFQGSREEENGLMESKKPKGKTYNRNNINQEE*
Ga0099822_105514053300006943Root NodulesLDIKIASYLDVKVPFQASREDENGLMESKKPKGKTYNRNNINQEK*
Ga0099822_105845923300006943Root NodulesVKVPFQGSIEEEDGLIQSKKPKGKTYNRNNINQEE*
Ga0099822_106762023300006943Root NodulesVKVPFQGSREEDNGLMESKKSKGKTYNRNNINQEE*
Ga0099822_106875913300006943Root NodulesVKVPFQGSREEKNGLMDSKKPKEKTYNRNNINKEE*
Ga0099822_107161313300006943Root NodulesVKVPFQGSREEEDGLIENKKPKGKTYNRNNINQEE*
Ga0099822_107832113300006943Root NodulesDIKIASYLDVKVPFQGSREEENGLMESKKPKGKTYNRNNIN*
Ga0099822_108323023300006943Root NodulesVKVPFPGSREEEYGLMESKKSKGKTYNRYNINQEE*
Ga0099822_108338913300006943Root NodulesVAKSLVLHVKVPFQGSREEEDGLIESKKLKGKTYNRNNINQEE*
Ga0099822_108413113300006943Root NodulesVEVPLQGSREEEDGLIESKKPKGKTYNRNNINQEE*
Ga0099822_110155313300006943Root NodulesVKVPFLGSREEENGLMGSKKSKGKTYNRNNINQEE*
Ga0099822_111153923300006943Root NodulesDVKVPFQGSREEENGLMESKKPKGKTYNRNNINQEE*
Ga0099822_111689023300006943Root NodulesVKVPFQGFKEDEDGLIESKKPKGKTYNRNNINQEE*
Ga0099823_103517713300006944Root NodulesLDIKIASYLDVKVPFQGSREEENGLMESKKPKGKTYNRNNIN*
Ga0099823_106439743300006944Root NodulesLDIKITSYLEVKVPFQGSREEENGLIGSKKPKGKTYTRNNIN*
Ga0099823_109192413300006944Root NodulesVKVPFQGSREEKNGLMDSKKPKEKTYNRNNINQEE*
Ga0099823_110469813300006944Root NodulesVKVPFQGSREEENGLMESKKSKGKTYNRNNINQEE*
Ga0214544_1000103713300021320Root NodulesMKVPFQGSREEENGLMESKKPKGKTYNRNNINQEE
Ga0214544_1000776343300021320Root NodulesLDIKIASYLDVKVPFQGSREEENGLMESKKPKGKTYNRNNIN
Ga0214544_100117713300021320Root NodulesVAKSLVLHVKVPFQGSREEEDGLIESKKLKGKTYNRNNINQEE
Ga0214544_1001849143300021320Root NodulesVKVSFQGSREEKNGLMESKKPKGKTYNRNNINQEE
Ga0214544_100184923300021320Root NodulesLDIKIASYLDVKVPFQASREDENGLMESKKPKGKTYNRNNINQEK
Ga0214544_100272893300021320Root NodulesVKVPFQGSIEEEDGLIQSKKPKGKTYNRNNINQEE
Ga0214544_1002804163300021320Root NodulesVKVPFQGSKEGKKGLMKSKKPKGKTYNRNNINQKE
Ga0214544_1004226363300021320Root NodulesVKVPFEGSREEEDGLMESKKPKGKTYNSNNINQEE
Ga0214544_1004382123300021320Root NodulesVKVSFQGSREEEDGLIESKKPKGKTYNRNNINQEEQRDIK
Ga0214544_1004385293300021320Root NodulesVKVPFQGSREDEDGLIESKKPKGKTYNRNNINQEE
Ga0214544_100535753300021320Root NodulesMKVPFQGSREEEDGLIESKKPKGKTYNKKNINQEE
Ga0214544_1005591193300021320Root NodulesVKVPFQGSREEENGLMESKKPQGKTYNRNNINQEE
Ga0214544_1005988203300021320Root NodulesVKVPFQGSREEENGLMGSKKSKGKTYNRNNINQEE
Ga0214544_100715433300021320Root NodulesMIASYLDVKVPFQGSREEEDGLMENKKPKGKSYNRKNINQEE
Ga0214544_100828923300021320Root NodulesVKVPFQGSKEEENELMENKKPKGKTYNRNNINQEE
Ga0214544_1008378123300021320Root NodulesMKVPFQGSKEEENGLMESKKPKGKTYNRNNINQEE
Ga0214544_100837893300021320Root NodulesMKVPFQGSKEEENGLMESKKPKGKTYNRNNINQKE
Ga0214544_1008388103300021320Root NodulesVKVPFEGSNEEENGLMESKKPKGKTYNRNNINQEE
Ga0214544_1008724143300021320Root NodulesVKVPFQGSREEENGLMESKKPKGKTYNRNNINQEE
Ga0214544_100937973300021320Root NodulesVKVPFQGSTEEEDGLIESKKPKGKTYNRNNINQEE
Ga0214544_1009691123300021320Root NodulesVKVPFQGSREEENGLMESNKPKGKTYNRNNINQEE
Ga0214544_1010182113300021320Root NodulesVKVPFQGSREEKNGLMEIKKPKEKTYNREKRNREE
Ga0214544_101029423300021320Root NodulesVKVPFQGSREEEDGLIESKKPKGKTYNRKNINQEE
Ga0214544_1010554153300021320Root NodulesVKVPFQGFKEDEDGLIESKKPKGKTYNRNNINQEE
Ga0214544_101135353300021320Root NodulesVKVPFQGSKEDEDGLIESKKPKGKTYNRNNINQEE
Ga0214544_1012402113300021320Root NodulesVKVPFQGSREEEDGFIESKKPKGKTYNKNNINQEE
Ga0214544_101286143300021320Root NodulesMIASYLDVKVPFQCSREEENGLMESKKPKGKTYTRNNINREE
Ga0214544_101308633300021320Root NodulesVKVAFQGYREEEDGLIESMKPKGKTYNRNNINQEE
Ga0214544_101330523300021320Root NodulesVKVPFQGFREEENGLMKSMKPKGKTYNRNNINQEE
Ga0214544_101429623300021320Root NodulesVEVPFQGSREEEDGLIESKKPKGKTYNRNNTNEEE
Ga0214544_101454153300021320Root NodulesMKVPFQGSREEENGLMESRKSKGKTYNRNNINQEE
Ga0214544_1015206123300021320Root NodulesVKVPFQGSREEENGLMGSKKSKEKTYNRNNINQEE
Ga0214544_101533513300021320Root NodulesVKVPFQGSREDENGLMGSKKSKGKTYNRNNINQEE
Ga0214544_101585413300021320Root NodulesVRVPFQGSREEENGLMGSKKSKGKTYNRNNINQEE
Ga0214544_101649043300021320Root NodulesVKVPFPGSREEEYGLMESKKSKGKTYNRYNINQEE
Ga0214544_101807723300021320Root NodulesVKVPFQGSRKEEDGWIESKKPKGKTYNRININQEE
Ga0214544_102034853300021320Root NodulesVKVPFQGSREEEDGLIESKKPKGKTYNRNNINQEE
Ga0214544_102057513300021320Root NodulesVKVPFQGSREEENGLMRSKKSKGKTYNRNNINQEE
Ga0214544_102187333300021320Root NodulesVKVPFQGFREDEDGLIESKKPKGKTYNRNNINKEE
Ga0214544_102268013300021320Root NodulesVKVPFQGSREEENGLMESKKSKGKTYNRNNINKEE
Ga0214544_102293533300021320Root NodulesVKVPFQGSREEEDGLIENKKPKGKTYNRNNINQEE
Ga0214544_102361023300021320Root NodulesVKVPFQGSREEKNGLMESKKPNGKTYNRNNINREE
Ga0214544_102690523300021320Root NodulesVTVPFQGSREEEDGLIESKKPKGKTYNRNNINQED
Ga0214544_103497133300021320Root NodulesVKVPFQGSREEENGLMGSKKSKGKTYNRNNINKEE
Ga0214544_103813313300021320Root NodulesVKVPFQGSREEENGLMESKKSKGKTYNRNNINQEE
Ga0214544_103926733300021320Root NodulesVKVPFQGSREEEKGLMGSKKSKGKTYNRNNINQEE
Ga0214544_104039013300021320Root NodulesVKVPFQGSREEKNGLMDSKKPKEKTYNRNNINQEE
Ga0214544_104194023300021320Root NodulesVEVPLQGSREEEDGLIESKKPKGKTYNRNNINQEE
Ga0214544_104260113300021320Root NodulesVKVPFQGSREEENGLMGSKKSKGKTYNKNNINQEE
Ga0214544_104429113300021320Root NodulesVKVPFQGSREEENGLMGNKKSKGKTYNRNNINQEE
Ga0214544_104587713300021320Root NodulesVKVPFQGSREEENGLIGSKKSKGKTYNRNNINQEE
Ga0214544_106118023300021320Root NodulesMVPFQGSREGENGLMGSKKSKGKTYNRNNINQEEYRNIK
Ga0214542_1003523133300021321Root NodulesVKVPFQGSREEENRLMESKKPKGKAYNRNNINREE
Ga0214542_101610343300021321Root NodulesLKVPFQGSREEEHGLIESKKPKGKTYNRNNINQEE
Ga0214542_102420813300021321Root NodulesVKVPFQGSREEDNGLMESKKSKGKTYNRNNINQEE
Ga0214545_102628823300021324Root NodulesLDIKITSYLEVKVPFQGSREEENGLIGSKKPKGKTYTRNNIN
Ga0214545_103512713300021324Root NodulesVKVPFQGSKEEENGLMGSKKSKGKTYNRNNINQEE
Ga0214545_106280933300021324Root NodulesKIASYLDVKVPFQGSREEENGLMESKKSKGKTYNRNNINQEE
Ga0214545_106418013300021324Root NodulesVKVPVQGSREEENGLMGSKKSKGKTYNRNNINQEE
Ga0209389_103026513300027296Root NodulesSYLDVKVPFQRSREEDNGLMESKKPKGKTYNRNNINQ
Ga0209389_111015523300027296Root NodulesVNIPFEGSREEEDGLIENKKPKGKTYNRNNINQEE
Ga0209389_112107423300027296Root NodulesVKGPFHGSREEENGLMGSKKSKEKTYNRNNINQEE
Ga0209389_112273913300027296Root NodulesVKVPFLGSREEENGLMGSKKSKGKTYNRNNINQEE
Ga0209589_104341713300027357Root NodulesVKVPFQGSREEENGLIGSKKSKEKTYNRNNINQKE
Ga0209589_104506833300027357Root NodulesVKAPFQGSREEENGLMGSKKSKGKTYNRNNINQEE
Ga0209589_105417613300027357Root NodulesYLDVKVPFQGSREEEDGLIESKKPKGKTYNRNNINQEE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.