| Basic Information | |
|---|---|
| Family ID | F088358 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MVVLDGASLTIDSLAAVAEGRDEVVLAPAARDRMAAAREVVEEAL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.91 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 98.17 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.312 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.532 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.450 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.367 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 15.56% Coil/Unstructured: 28.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF02574 | S-methyl_trans | 18.35 |
| PF00221 | Lyase_aromatic | 13.76 |
| PF02694 | UPF0060 | 6.42 |
| PF02900 | LigB | 5.50 |
| PF00392 | GntR | 5.50 |
| PF00881 | Nitroreductase | 5.50 |
| PF00557 | Peptidase_M24 | 4.59 |
| PF13377 | Peripla_BP_3 | 4.59 |
| PF00724 | Oxidored_FMN | 4.59 |
| PF00743 | FMO-like | 2.75 |
| PF01381 | HTH_3 | 1.83 |
| PF14306 | PUA_2 | 1.83 |
| PF00501 | AMP-binding | 0.92 |
| PF03551 | PadR | 0.92 |
| PF12770 | CHAT | 0.92 |
| PF07969 | Amidohydro_3 | 0.92 |
| PF01904 | DUF72 | 0.92 |
| PF00933 | Glyco_hydro_3 | 0.92 |
| PF02657 | SufE | 0.92 |
| PF01266 | DAO | 0.92 |
| PF00709 | Adenylsucc_synt | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 18.35 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 18.35 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 13.76 |
| COG1742 | Uncharacterized inner membrane protein YnfA, drug/metabolite transporter superfamily | General function prediction only [R] | 6.42 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 4.59 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 4.59 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 2.75 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.92 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.92 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.92 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.92 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.92 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.92 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.31 % |
| Unclassified | root | N/A | 25.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003659|JGI25404J52841_10015791 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300005179|Ga0066684_10071805 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300005332|Ga0066388_104811731 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005434|Ga0070709_10312082 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005434|Ga0070709_10824258 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005436|Ga0070713_101304710 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005437|Ga0070710_11196279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 561 | Open in IMG/M |
| 3300005451|Ga0066681_10874755 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005467|Ga0070706_100583584 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005467|Ga0070706_101016035 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005467|Ga0070706_101239999 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005471|Ga0070698_100818802 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005546|Ga0070696_100150923 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300005614|Ga0068856_101079948 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005764|Ga0066903_101881280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1146 | Open in IMG/M |
| 3300006028|Ga0070717_10380395 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300006034|Ga0066656_10249784 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300006954|Ga0079219_10178173 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300007258|Ga0099793_10221278 | Not Available | 910 | Open in IMG/M |
| 3300009088|Ga0099830_10937558 | Not Available | 716 | Open in IMG/M |
| 3300009089|Ga0099828_11465628 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009090|Ga0099827_10330147 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300009098|Ga0105245_11463237 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009162|Ga0075423_12413440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 573 | Open in IMG/M |
| 3300009551|Ga0105238_12395544 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010043|Ga0126380_10696431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 816 | Open in IMG/M |
| 3300010048|Ga0126373_10980170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300010335|Ga0134063_10094925 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300010358|Ga0126370_11531555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300010360|Ga0126372_12032612 | Not Available | 622 | Open in IMG/M |
| 3300010360|Ga0126372_13318313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300010366|Ga0126379_10663217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 1134 | Open in IMG/M |
| 3300010396|Ga0134126_12433023 | Not Available | 570 | Open in IMG/M |
| 3300011107|Ga0151490_1424122 | Not Available | 782 | Open in IMG/M |
| 3300012208|Ga0137376_11406127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 588 | Open in IMG/M |
| 3300012496|Ga0157353_1030777 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012685|Ga0137397_10207648 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012925|Ga0137419_10350865 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300012944|Ga0137410_11887624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300012948|Ga0126375_10110261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
| 3300012971|Ga0126369_10192773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1958 | Open in IMG/M |
| 3300013306|Ga0163162_10488336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1363 | Open in IMG/M |
| 3300013306|Ga0163162_10514695 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300014166|Ga0134079_10061861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 1344 | Open in IMG/M |
| 3300015245|Ga0137409_10631667 | Not Available | 902 | Open in IMG/M |
| 3300015373|Ga0132257_101636713 | Not Available | 824 | Open in IMG/M |
| 3300016357|Ga0182032_11877366 | Not Available | 524 | Open in IMG/M |
| 3300016387|Ga0182040_11279083 | Not Available | 619 | Open in IMG/M |
| 3300016445|Ga0182038_10759419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300017999|Ga0187767_10203746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. SBT364 | 627 | Open in IMG/M |
| 3300024249|Ga0247676_1034144 | Not Available | 818 | Open in IMG/M |
| 3300024317|Ga0247660_1077961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300025910|Ga0207684_10310122 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300025922|Ga0207646_10120187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2360 | Open in IMG/M |
| 3300025928|Ga0207700_10237144 | Not Available | 1553 | Open in IMG/M |
| 3300025932|Ga0207690_10244455 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300026301|Ga0209238_1106615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300027874|Ga0209465_10113372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300027894|Ga0209068_10647528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300028380|Ga0268265_10407981 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300028710|Ga0307322_10196404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300028782|Ga0307306_10069280 | Not Available | 905 | Open in IMG/M |
| 3300029636|Ga0222749_10194874 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300031544|Ga0318534_10306193 | Not Available | 915 | Open in IMG/M |
| 3300031545|Ga0318541_10445857 | Not Available | 724 | Open in IMG/M |
| 3300031573|Ga0310915_10641902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 751 | Open in IMG/M |
| 3300031640|Ga0318555_10397912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300031681|Ga0318572_10765336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 574 | Open in IMG/M |
| 3300031682|Ga0318560_10511882 | Not Available | 650 | Open in IMG/M |
| 3300031708|Ga0310686_110373055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | 507 | Open in IMG/M |
| 3300031736|Ga0318501_10047898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1983 | Open in IMG/M |
| 3300031736|Ga0318501_10584040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300031736|Ga0318501_10670592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031740|Ga0307468_101547095 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031747|Ga0318502_10171021 | Not Available | 1247 | Open in IMG/M |
| 3300031748|Ga0318492_10648287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | 565 | Open in IMG/M |
| 3300031751|Ga0318494_10602229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | 642 | Open in IMG/M |
| 3300031765|Ga0318554_10538340 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031771|Ga0318546_10283688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1144 | Open in IMG/M |
| 3300031777|Ga0318543_10069741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1471 | Open in IMG/M |
| 3300031805|Ga0318497_10103408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
| 3300031833|Ga0310917_10657253 | Not Available | 711 | Open in IMG/M |
| 3300031859|Ga0318527_10142387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | 1003 | Open in IMG/M |
| 3300031860|Ga0318495_10501933 | Not Available | 529 | Open in IMG/M |
| 3300031896|Ga0318551_10375069 | Not Available | 807 | Open in IMG/M |
| 3300031897|Ga0318520_10819355 | Not Available | 584 | Open in IMG/M |
| 3300031911|Ga0307412_11275457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 660 | Open in IMG/M |
| 3300031947|Ga0310909_10258204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1456 | Open in IMG/M |
| 3300032009|Ga0318563_10568339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 612 | Open in IMG/M |
| 3300032009|Ga0318563_10656430 | Not Available | 564 | Open in IMG/M |
| 3300032009|Ga0318563_10698309 | Not Available | 545 | Open in IMG/M |
| 3300032025|Ga0318507_10156623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300032025|Ga0318507_10236802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces nanshensis | 791 | Open in IMG/M |
| 3300032039|Ga0318559_10360748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 676 | Open in IMG/M |
| 3300032041|Ga0318549_10379716 | Not Available | 637 | Open in IMG/M |
| 3300032041|Ga0318549_10547751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. SBT364 | 519 | Open in IMG/M |
| 3300032044|Ga0318558_10410633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300032052|Ga0318506_10466172 | Not Available | 560 | Open in IMG/M |
| 3300032052|Ga0318506_10550734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300032055|Ga0318575_10631600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | 542 | Open in IMG/M |
| 3300032055|Ga0318575_10641526 | Not Available | 538 | Open in IMG/M |
| 3300032060|Ga0318505_10364726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300032068|Ga0318553_10510016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300032090|Ga0318518_10453867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300032174|Ga0307470_11171930 | Not Available | 622 | Open in IMG/M |
| 3300032205|Ga0307472_101049180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
| 3300032261|Ga0306920_101617152 | Not Available | 921 | Open in IMG/M |
| 3300033290|Ga0318519_10110903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
| 3300033418|Ga0316625_102002124 | Not Available | 570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25404J52841_100157911 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MVLLDGASLTIESLAAVAEGRDQAVLAPAARERMAEARKVVEEAMRSE |
| Ga0066684_100718053 | 3300005179 | Soil | MVVLDGASLTIESLAAIAEGGDKAILAPAARDRMAEARKVVEEAM |
| Ga0066388_1048117313 | 3300005332 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAEGRDEVVLAPAARDRMAAAREVVEEAL |
| Ga0070709_103120822 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIESLAAIAEGRDKVILAPAARDRMAEARKVVEEALRSE |
| Ga0070709_108242582 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEAMRSEAAVY |
| Ga0070713_1013047102 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGVSLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEA |
| Ga0070710_111962792 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIESLAAIAEGRDKVILAPAARDRMAEARKVVEEALRSEAAV |
| Ga0066681_108747551 | 3300005451 | Soil | MVVLDGASLTIESLAAVAEGREQAILAPAARDRMAEARKVVEEAMRSEA |
| Ga0070706_1005835841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIDSLAAVAEGRDQVALAPAARDRMAAAREVVEEALRS |
| Ga0070706_1010160352 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGTSLTIESLAAVAEGRDKAILAPAARDRMAEARKVVEE |
| Ga0070706_1012399992 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIDSLAAVAEGRDEVVLARAARDRMAAAREVVEEALRS |
| Ga0070698_1008188021 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMVVLDGASLTIDSLAAVAEGRDEVVLAPAARDRMAAAR |
| Ga0070696_1001509233 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEA |
| Ga0068856_1010799481 | 3300005614 | Corn Rhizosphere | MVVLDGASLTIDSLAAVAERRDEVVLAPLARDRMAAAREVVEEAL |
| Ga0066903_1018812802 | 3300005764 | Tropical Forest Soil | MVVLDGTSLTIDSLAVVAEGREKVALAPAARDRMAAAREVVEEAM |
| Ga0070717_103803951 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIDSLAAVAEGRAQVALAPAARNRMAAAREI |
| Ga0066656_102497841 | 3300006034 | Soil | MVVLDGASLTIDSLAAVAERRDEVVLAPLARDRMAAARKVVEEALRADAPVY |
| Ga0079219_101781732 | 3300006954 | Agricultural Soil | MVVLDGASLTIESLAAVAEGREQAILAPAARDRMAEARKVVEEAMRS |
| Ga0099793_102212781 | 3300007258 | Vadose Zone Soil | MVVLDGASLTIESLAAVAEGRDNAILAPAARDRMAEARKVVEES |
| Ga0099830_109375581 | 3300009088 | Vadose Zone Soil | MVVLDGASLTIDSLAAVAEGQDEVVLAPAARDRMAAAREVVEEALRLD |
| Ga0099828_114656281 | 3300009089 | Vadose Zone Soil | MVVLDGASLTIESLAAVAEGRDKAILAPAARDRMAE |
| Ga0099827_103301471 | 3300009090 | Vadose Zone Soil | MVVLDGESLTIESLAAVAEGRDKAILAPAARDRMAEA |
| Ga0105245_114632371 | 3300009098 | Miscanthus Rhizosphere | MVVLDGVSLTIESLAAVAEGRDKAILAPAARDRMAE |
| Ga0075423_124134402 | 3300009162 | Populus Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEAMRSEAA |
| Ga0105238_123955441 | 3300009551 | Corn Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEAMRSEA |
| Ga0126380_106964312 | 3300010043 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAEGRDEVALAPAARDRMAAAREIVEEALRS |
| Ga0126373_109801701 | 3300010048 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAERDDEVTLAPAALDRMAAAREIVEEALRS |
| Ga0134063_100949252 | 3300010335 | Grasslands Soil | MVVLDGASLTIESLAAVAEGRDKAILAPAARDRMAEARKVVEEAM |
| Ga0126370_115315552 | 3300010358 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAEGSDEVALDPAARDRMAAAREIVEDA |
| Ga0126372_120326121 | 3300010360 | Tropical Forest Soil | MVVLDGTSLTIDSLAAVAEGREKVSLAPAARDRMA |
| Ga0126372_133183131 | 3300010360 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAEGGEEAVLAPAARDRMAAAR |
| Ga0126379_106632172 | 3300010366 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAEGCDEVVLAPAARDRMAAARE |
| Ga0134126_124330231 | 3300010396 | Terrestrial Soil | MVVLDGASLTIDSLAAVAERRDEVVLAPLARDRMAAAREVVEE |
| Ga0151490_14241222 | 3300011107 | Soil | MVVLDGASLTIESLAAVAEGRDKAILAPAARDRMAEAREVVEE |
| Ga0137376_114061272 | 3300012208 | Vadose Zone Soil | MVVLDGASLTIDSLAAVAERRDEVALAPAARDRMAA |
| Ga0157353_10307771 | 3300012496 | Unplanted Soil | MVVLDGASLTIESLAAVAEGRDRAILAPAARDRMAEARKVVEEAMR |
| Ga0137397_102076483 | 3300012685 | Vadose Zone Soil | MVVLDGASLTIESLAAIAERRDKVILAPAARDRMAEARKVVEEA |
| Ga0137419_103508651 | 3300012925 | Vadose Zone Soil | VALMVVLDGASLTIESLAAIAEGRDKVILAAAARDRMAEARKVVE |
| Ga0137410_118876243 | 3300012944 | Vadose Zone Soil | MVVLDGASLTIESLAAVAEGRDTAILAPAARDRMA |
| Ga0126375_101102613 | 3300012948 | Tropical Forest Soil | MVVLDGASLTIDSLSAVAEGRDGVGLAPAARDRMAAAREVVEEALRS |
| Ga0126369_101927733 | 3300012971 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAERQDEVVLAPAARERMAAAREVVEEALRGE |
| Ga0163162_104883363 | 3300013306 | Switchgrass Rhizosphere | MVVLDGASLTIDSLAAVAERRDEVVLAPLARDRMAAA |
| Ga0163162_105146952 | 3300013306 | Switchgrass Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVV |
| Ga0134079_100618611 | 3300014166 | Grasslands Soil | MVVLDGASLTIDSLAAVAEGCDEAALAPAARDRMAAAREIVEEALRSE |
| Ga0137409_106316672 | 3300015245 | Vadose Zone Soil | MVVLDGASLTIESLAAVAEGRDNAILAPAARDRMAEARKVVEESLRSEAA |
| Ga0132257_1016367131 | 3300015373 | Arabidopsis Rhizosphere | MVVLDGASLTIESLAAVAEGRDRAILAPAARDRMAE |
| Ga0182032_118773661 | 3300016357 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALASVARDRMAAAREVVEEALRSGA |
| Ga0182040_112790832 | 3300016387 | Soil | MLVLDGASLTIDALAAVAEGREEVALAPAARDRMAAARGVVEEALRL |
| Ga0182038_107594192 | 3300016445 | Soil | MVVLDGASLTIDSLAAVAEEGDEVVLAPAARDRMAAAREIVEEALRSEA |
| Ga0187767_102037462 | 3300017999 | Tropical Peatland | MVVLDGASLTIDSLAAVAGGQAEVALAPAARDRMAA |
| Ga0247676_10341441 | 3300024249 | Soil | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAE |
| Ga0247660_10779612 | 3300024317 | Soil | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEAMRSEAAV |
| Ga0207684_103101221 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIESLAAVAEGRDKAILAPAARDRMAEARK |
| Ga0207646_101201871 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGTSLTIESLAAVAEGRDKAILAPAARDRMAEARK |
| Ga0207700_102371442 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLDGASLTIDSLAAVAEGSDEVALDPAARDRMAAA |
| Ga0207690_102444552 | 3300025932 | Corn Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEAMRS |
| Ga0209238_11066151 | 3300026301 | Grasslands Soil | MVVLDGASLTIDSLAAVAEGRDEIALAPAARDRMAAARE |
| Ga0209465_101133723 | 3300027874 | Tropical Forest Soil | MVVLDGASLTIDSLAAVAERGDEVVLAAAARDRMAAAREIVEEALR |
| Ga0209068_106475282 | 3300027894 | Watersheds | MVVLDGASLTIDSLAAVAEGRDEVVLAPAARDRMTAAREIVD |
| Ga0268265_104079812 | 3300028380 | Switchgrass Rhizosphere | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMAEARKVVEEAMRSE |
| Ga0307322_101964041 | 3300028710 | Soil | MVVLDGASLTIESLAAVAEGQDEAILAPAARDRMAEARKVVEEAMRSEAA |
| Ga0307306_100692801 | 3300028782 | Soil | MVVLDGASLTIDSLAVVAERRDEVVLAPLARDRMAAAREVVEEVLRADAP |
| Ga0222749_101948742 | 3300029636 | Soil | MVVLDGVSLTIESLAAVAEGRDTAILAPAARDRMA |
| Ga0318534_103061931 | 3300031544 | Soil | MVVLDGESLTVDSLAAVAAGRDEVALTPAARDRMAA |
| Ga0318541_104458571 | 3300031545 | Soil | MVVLDGASLTIDALAAVAEGREEVALAPAARDRMAAAREVVEE |
| Ga0310915_106419022 | 3300031573 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALAPVARDRMAAA |
| Ga0318555_103979121 | 3300031640 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALDPAARDRMAA |
| Ga0318572_107653362 | 3300031681 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALDPVARDRMA |
| Ga0318560_105118822 | 3300031682 | Soil | MVVLDGESLTVDSLAAVAAGRDEVALAPAARDRMAAA |
| Ga0310686_1103730551 | 3300031708 | Soil | MVMLDGMSLTIDSLAAVAEGHDEVVLAPAARDRMAAAREVVEEALRLNL |
| Ga0318501_100478983 | 3300031736 | Soil | MVVVDGASLTIDSVAAVAEGRDEVALDPAARDRMAA |
| Ga0318501_105840402 | 3300031736 | Soil | MVVIDGASLTIDSLAAVAEGSDEVALAPAARDRMAAAREVVEEALRA |
| Ga0318501_106705922 | 3300031736 | Soil | MVVLDGASLTIDSLAAVAERQEEVVLAPAARERMAAAREVVE |
| Ga0307468_1015470951 | 3300031740 | Hardwood Forest Soil | MVVLDGVSLTIESLAAVAEGRDKAILALAARDRMAEARK |
| Ga0318502_101710211 | 3300031747 | Soil | MVVLDGESLTVDSLAAVAAGRDEVALTPAARDRMAAARE |
| Ga0318492_106482872 | 3300031748 | Soil | MVVLDGTSLTIGSVAAVAEGRDQVVLAPAARDRMAAA |
| Ga0318494_106022292 | 3300031751 | Soil | MVVLDGTSLTIGSVAAVAEGRDEVVLAPAARDRMAAA |
| Ga0318554_105383402 | 3300031765 | Soil | MVVLDGTSLTIDSLAAVAEGREKVALAPAARDRMAAARE |
| Ga0318546_102836881 | 3300031771 | Soil | MVVLDGASLTIDSVAAVAEGRDEVALAPAARDRMA |
| Ga0318543_100697411 | 3300031777 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALDPAARDRMAAARE |
| Ga0318497_101034083 | 3300031805 | Soil | MVVLDGESLTVDSLAAVAAGRDEVALAPAARDRMAA |
| Ga0310917_106572532 | 3300031833 | Soil | MVVLDGESLTVDSLAAVAAGRDEVALAPAARDKMAAAREVVEEALRSGAI |
| Ga0318527_101423872 | 3300031859 | Soil | MVVLDGTSLTIGSVAAVAEGRDEVVLAPAARDRMAAAREVVEEALRLNLP |
| Ga0318495_105019331 | 3300031860 | Soil | MVVVDGTSLTIDSLAAVAEGREEIALAPAARDRMAAAREVVEEEQQELGWAR |
| Ga0318551_103750693 | 3300031896 | Soil | MLVLDGASLTIDALAAVAEGREEVALAPAARDRMAAAREVVEEA |
| Ga0318520_108193551 | 3300031897 | Soil | MVVVDGRSLTIDSLAEVAEGREEIALAPAARDRMA |
| Ga0307412_112754571 | 3300031911 | Rhizosphere | MQPTEVVLDGASLTVDLVRAVAEGGARVRLAPSAADR |
| Ga0310909_102582041 | 3300031947 | Soil | MVVLDGASLTIDSLAAVAEGGDEAVLAPAARDRMA |
| Ga0318563_105683392 | 3300032009 | Soil | MVVLDGESLTIDSLAAVAEGRDEVVLAPAARDRMT |
| Ga0318563_106564302 | 3300032009 | Soil | MVVVDGRSLTIDSLAEVAEGREEIALAPAARDRMAAAREVVEEALRLN |
| Ga0318563_106983091 | 3300032009 | Soil | MVVLDGTSLTIDSLAAVAEGREKVALASAARDRMAAAR |
| Ga0318507_101566232 | 3300032025 | Soil | MVVLDGASLTIESLAAVAEGGDEAVLAPAARDRMAAARGVVEEALRSGAI |
| Ga0318507_102368021 | 3300032025 | Soil | MVVLDGESLTVDSLAAVAAGRDEVALAPAARDKMAAAREVVEEALG |
| Ga0318559_103607482 | 3300032039 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALAPVARDRMAAARKVVEEALRSGATG |
| Ga0318549_103797162 | 3300032041 | Soil | MVVLDGASLTIDALAAVAEGREEVALAPAARDRMAAAREVV |
| Ga0318549_105477511 | 3300032041 | Soil | MVVLDGASLTIDSVAAVAEGRDEVALAPAARDRMAAARE |
| Ga0318558_104106331 | 3300032044 | Soil | MVVVLDGGSLTIDSLAAVAEGRVEVALAPAARDRMAAAREV |
| Ga0318506_104661722 | 3300032052 | Soil | MLVLDGASLTIDALAAVAEGREEVALAPAARDRMAAAREVVEEALRLNVS |
| Ga0318506_105507341 | 3300032052 | Soil | MVVLDGTSLTIDSLAAVADGREKVALAPAARDRMAAAR |
| Ga0318575_106316001 | 3300032055 | Soil | MVVLDGTSLTIGSVAAVAEGRDEVVLAPAARDRMAAAREVVEEALRLN |
| Ga0318575_106415262 | 3300032055 | Soil | MLVLDGASLTIDALAAVAEGREEVALAPAARDRMAAAREVVE |
| Ga0318505_103647261 | 3300032060 | Soil | MVVLDGASLTIDSLAAVAERSAEVALAPAARDRMAAARE |
| Ga0318553_105100162 | 3300032068 | Soil | MVVLDGASLTIDALAAVAEGSAEVALAPAARDRMA |
| Ga0318518_104538671 | 3300032090 | Soil | MVVLDGASLTIDSLAAVAEGSDEVALDPAARDRMAAAREVVEEA |
| Ga0307470_111719301 | 3300032174 | Hardwood Forest Soil | MVVLDGASLTIDSLAAVAERRDEVVLAPLARDRMAAAREV |
| Ga0307472_1010491801 | 3300032205 | Hardwood Forest Soil | MVVLDGASLTIESLAAVAEGRDEAILAPAARDRMTEARKV |
| Ga0306920_1016171523 | 3300032261 | Soil | MVVLDGASLTIDALAAVAEGREEVALAPAARDRMAAAREVVEEAL |
| Ga0318519_101109031 | 3300033290 | Soil | MVVVDGASLTIDSVAAVAEGRDEVALDPAARDRMAAARE |
| Ga0316625_1020021242 | 3300033418 | Soil | MVVLDGASLTLPSLMAVAEGHEPVALSPEARQRVEAARAV |
| ⦗Top⦘ |