NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088344

Metagenome / Metatranscriptome Family F088344

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088344
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 86 residues
Representative Sequence MQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Number of Associated Samples 106
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.75 %
% of genes near scaffold ends (potentially truncated) 57.80 %
% of genes from short scaffolds (< 2000 bps) 95.41 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.807 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(28.440 % of family members)
Environment Ontology (ENVO) Unclassified
(37.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(42.202 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 58.33%    β-sheet: 4.76%    Coil/Unstructured: 36.90%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00581Rhodanese 77.06
PF04143Sulf_transp 9.17
PF03441FAD_binding_7 5.50
PF05199GMC_oxred_C 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG2391Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domainsGeneral function prediction only [R] 9.17
COG0415Deoxyribodipyrimidine photolyaseReplication, recombination and repair [L] 5.50
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.81 %
UnclassifiedrootN/A31.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000928|OpTDRAFT_10168388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.1234Open in IMG/M
3300001282|B570J14230_10076359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1048Open in IMG/M
3300001950|GOS2227_1054850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1464Open in IMG/M
3300002161|JGI24766J26685_10111661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300003413|JGI25922J50271_10042868All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300003413|JGI25922J50271_10063427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300003429|JGI25914J50564_10169506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300003754|Ga0005853_1000935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1403Open in IMG/M
3300004054|Ga0063232_10057348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1037Open in IMG/M
3300005517|Ga0070374_10227540All Organisms → cellular organisms → Bacteria → Proteobacteria956Open in IMG/M
3300006030|Ga0075470_10022630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1949Open in IMG/M
3300007162|Ga0079300_10167210Not Available589Open in IMG/M
3300007165|Ga0079302_1070130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300007363|Ga0075458_10101395Not Available896Open in IMG/M
3300007548|Ga0102877_1058633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1109Open in IMG/M
3300007554|Ga0102820_1078000Not Available796Open in IMG/M
3300007561|Ga0102914_1234799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300007585|Ga0102916_1129916Not Available678Open in IMG/M
3300007597|Ga0102919_1097445Not Available924Open in IMG/M
3300007600|Ga0102920_1085479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium999Open in IMG/M
3300007600|Ga0102920_1231946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300007606|Ga0102923_1032715All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300007617|Ga0102897_1016360All Organisms → cellular organisms → Bacteria2363Open in IMG/M
3300007620|Ga0102871_1144046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300007624|Ga0102878_1124433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300007625|Ga0102870_1041254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1377Open in IMG/M
3300007630|Ga0102903_1059427Not Available1067Open in IMG/M
3300007634|Ga0102901_1136303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300007644|Ga0102902_1016702All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300007658|Ga0102898_1025002Not Available1331Open in IMG/M
3300007670|Ga0102862_1110761Not Available691Open in IMG/M
3300007681|Ga0102824_1051068All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300007708|Ga0102859_1039971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1280Open in IMG/M
3300007954|Ga0105739_1178823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300007974|Ga0105747_1075428Not Available1027Open in IMG/M
3300008052|Ga0102893_1026605All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300008108|Ga0114341_10073116All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300008262|Ga0114337_1083364All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300008996|Ga0102831_1210152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300009058|Ga0102854_1020931All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300010309|Ga0102890_1052257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium809Open in IMG/M
3300010354|Ga0129333_10935903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium731Open in IMG/M
3300010966|Ga0137675_1013472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300011009|Ga0129318_10162181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300011009|Ga0129318_10168890Not Available679Open in IMG/M
3300012706|Ga0157627_1160723All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300012722|Ga0157630_1283889Not Available596Open in IMG/M
3300012727|Ga0157531_1262337Not Available528Open in IMG/M
3300012730|Ga0157602_1318210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300013005|Ga0164292_10869346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300013074|Ga0157618_1079992Not Available750Open in IMG/M
3300015243|Ga0180041_136194Not Available807Open in IMG/M
3300020487|Ga0208200_114570Not Available629Open in IMG/M
3300020536|Ga0207939_1021071Not Available912Open in IMG/M
3300020543|Ga0208089_1019407All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300020551|Ga0208360_1023587All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300020552|Ga0207940_1040927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300020553|Ga0208855_1052970Not Available526Open in IMG/M
3300020561|Ga0207934_1071285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300020565|Ga0208718_1047788All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300020574|Ga0208221_1047900All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300020575|Ga0208053_1037857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium922Open in IMG/M
3300021108|Ga0214162_1072172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300021140|Ga0214168_1114000Not Available570Open in IMG/M
3300021961|Ga0222714_10550328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300021962|Ga0222713_10235290Not Available1202Open in IMG/M
3300021963|Ga0222712_10440152Not Available783Open in IMG/M
3300024533|Ga0256299_1023465Not Available1183Open in IMG/M
3300024544|Ga0255294_1055505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300024560|Ga0256306_1074819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300024573|Ga0256337_1033103Not Available1306Open in IMG/M
3300024574|Ga0255275_1073790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300024852|Ga0255295_1101119Not Available553Open in IMG/M
3300025170|Ga0209413_1013427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium832Open in IMG/M
3300025445|Ga0208424_1026954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300025635|Ga0208147_1039085Not Available1235Open in IMG/M
3300025896|Ga0208916_10302423Not Available697Open in IMG/M
3300026425|Ga0256300_1006329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1520Open in IMG/M
3300027084|Ga0208443_1077215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300027114|Ga0208009_1002013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila5700Open in IMG/M
3300027153|Ga0255083_1028299Not Available1176Open in IMG/M
3300027155|Ga0255081_1020322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1510Open in IMG/M
3300027219|Ga0208167_1069920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300027225|Ga0208025_1014446Not Available1424Open in IMG/M
3300027227|Ga0208929_1025750Not Available1329Open in IMG/M
3300027229|Ga0208442_1059748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300027244|Ga0208173_1025394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1143Open in IMG/M
3300027250|Ga0208310_1046369Not Available650Open in IMG/M
3300027260|Ga0208027_1040855Not Available945Open in IMG/M
3300027720|Ga0209617_10251496Not Available670Open in IMG/M
3300027769|Ga0209770_10051362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1749Open in IMG/M
3300028105|Ga0255254_1023211Not Available1229Open in IMG/M
3300028113|Ga0255234_1042283Not Available1193Open in IMG/M
3300031784|Ga0315899_11318343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300031857|Ga0315909_10293528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1220Open in IMG/M
3300032116|Ga0315903_10464233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1011Open in IMG/M
3300033981|Ga0334982_0302251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300033996|Ga0334979_0012811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila5737Open in IMG/M
3300034012|Ga0334986_0441133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300034022|Ga0335005_0186314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1296Open in IMG/M
3300034062|Ga0334995_0667130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300034093|Ga0335012_0131580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1377Open in IMG/M
3300034096|Ga0335025_0668902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300034101|Ga0335027_0817868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300034111|Ga0335063_0548976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300034118|Ga0335053_0420042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales807Open in IMG/M
3300034280|Ga0334997_0606205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300034284|Ga0335013_0776229Not Available538Open in IMG/M
3300034355|Ga0335039_0153250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1302Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine28.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater10.09%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater10.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.75%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.75%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.75%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.83%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.83%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.83%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.92%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.92%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.92%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001950Marine microbial communities from Delaware Bay, New Jersey, USA - GS011EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003754Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007165Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010966Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016EnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012727Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013074Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300015243Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020487Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020552Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020561Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020565Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020574Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020575Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021140Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024533Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024544Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024574Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024852Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025170Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027084Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027155Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027219Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027225Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027227Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027244Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027250Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300028105Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OpTDRAFT_1016838823300000928Freshwater And MarineMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVXXXAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR*
B570J14230_1007635923300001282FreshwaterPVAIATSTERNGVVFLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERTNAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
GOS2227_105485023300001950MarineMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEVAAPMVLGLLLCCGLIEITLLPR*
JGI24766J26685_1011166123300002161Freshwater And SedimentMQKKQKRPRSXXSPKLTPXKSEXGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
JGI25922J50271_1004286823300003413Freshwater LakeMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAARRSAAITPKETAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
JGI25922J50271_1006342723300003413Freshwater LakeMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
JGI25914J50564_1016950613300003429Freshwater LakeMQKKQKRPRSSNKPRLIPIRSEIGAVELDVFEERINARRRSAAITAKEIAVRTFSLAVHAEAATPRSPRLLLCVGRVEITLLPRLCLKDY*
Ga0005853_100093523300003754Freshwater And SedimentIDPVAIATRTEINGVVFLSSIPSRKIQKKQKRPRSSNRPRLIPIRREIGAVELLTLEERINAVRSKAAITAKEIAVRIFSARVHAEAATPENPELLLCV*
Ga0063232_1005734823300004054Freshwater LakeVFLSSMPSRKMQKKQKRPRSSNKPRLIPIRSEIGAVELDVFEERINARRRSAAITAKEIAVRTFSLAVHAEAATPRSPRLLLCVGRVEITLLPRLCLKDY*
Ga0070374_1022754023300005517Freshwater LakeMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0075470_1002263013300006030AqueousSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR*
Ga0079300_1016721013300007162Deep SubsurfaceKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0079302_107013013300007165Deep SubsurfaceRTEINGVVFLSSIPSRKIQKKQKRPRSSNRPRLIPIRSEIGAVELLTLEERMNAVRSKAAITAKEIAVRIFSARVHAEAATPELPELLLCV*
Ga0075458_1010139523300007363AqueousRKIQKKQKRPRSSNRPRLIPIRREIGAVELLTLEERINAVKSKAAITAKEIAVRIFSARVHAEAATPGLPELLLCV*
Ga0102877_105863323300007548EstuarineATSTERNGVVFLSSIPSRKMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFEERINAVSKREAITPNEIVVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR*
Ga0102820_107800013300007554EstuarinePVAIATSTERNGVAFLSSIPSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102914_123479923300007561EstuarineMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMDLGLLLCCGLIEITLLPR*
Ga0102916_112991623300007585EstuarineRSSNSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102919_109744523300007597EstuarineSSKSPKLIPIKSEIGAVELLVFDERINAMSKREAITPNEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR*
Ga0102920_108547923300007600EstuarineSSIPSRKIQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102920_123194613300007600EstuarineMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAATPMVLGLLLCCGLIEITLLPR*
Ga0102923_103271513300007606EstuarineKRPRSSKSPKLIPITSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102897_101636043300007617EstuarineINGVVFLSSIPSRKIQKKQKRPRSSKRPRLIPIRREIGAVELLTLEERINAVRSKAAMTAKEIAVRIFSARVHAEAATPGLPELLLCV*
Ga0102871_114404623300007620EstuarineLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIVVRIFSARVQAEVAAPIVLGLPLCCGLIEITLLPR*
Ga0102878_112443323300007624EstuarineVFLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPK*
Ga0102870_104125413300007625EstuarineMQKKQKRPRSSSSPKLTPIKSEIGAVELLVFEERINVVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102903_105942713300007630EstuarineKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAATPMVLGLLLCCGLIEITLLPR*
Ga0102901_113630323300007634EstuarineMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102902_101670223300007644EstuarineMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102898_102500213300007658EstuarineKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVHRKPAAPMVLGLLLCCGLIEITLLPR*
Ga0102862_111076123300007670EstuarineRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVHRKPAAPMVLGLLLCCGLIEITLLPR*
Ga0102824_105106823300007681EstuarineMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102859_103997123300007708EstuarineMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR*
Ga0105739_117882323300007954Estuary WaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERTNAVIRSAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEIMLLPR*
Ga0105747_107542823300007974Estuary WaterLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102893_102660513300008052EstuarineSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAATPMVLGLLLCCGLIEITLLPR*
Ga0114341_1007311633300008108Freshwater, PlanktonVAIATSTERKGVAFLSSIPSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0114337_108336433300008262Freshwater, PlanktonQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102831_121015213300008996EstuarineRNGVVFLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEIMLLPR*
Ga0102854_102093113300009058EstuarinePVAIATSTERNGVAFLSSIPSRKMQKKQKRPRSSHSPKLTPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0102890_105225723300010309EstuarineVAIATSTERNGVEFLSSIPSRKIQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVTRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0129333_1093590323300010354Freshwater To Marine Saline GradientAIATSTERNGVVFLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVKRRAAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0137675_101347213300010966Pond Fresh WaterLSSIPSRKIQKKQKRPRSSNRPRLIPIRREIGAVELLTLEERINAVKSKAAITAKEIAVRIFSARVHAEAATPEIPELLLCV*
Ga0129318_1016218123300011009Freshwater To Marine Saline GradientTSTERNGVVFLSSMPSRKMQKKQKRPRSRRRPRLIPIRREIGAVELEVLEERIKAKRRSAAMTAKEIAVRIFSLRVHAEAATPDVPRLLPCVD*
Ga0129318_1016889023300011009Freshwater To Marine Saline GradientRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0157627_116072323300012706FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0157630_128388923300012722FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAARRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0157531_126233713300012727FreshwaterRLIPIRRETGAVELEVLEERINARRRSAAITAKEIAVRTFSLAVHAEAATPVFARLLLCVGRVEITLLPRLCLKGY*
Ga0157602_131821013300012730FreshwaterVVFLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAARRSAAITPKETAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0164292_1086934613300013005FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFEERINAVIRSAAITPNEIAVRIFSSRVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0157618_107999213300013074FreshwaterQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0180041_13619423300015243FreshwaterPSRKMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR*
Ga0208200_11457023300020487FreshwaterRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERTNAVRRRAAITPNEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR
Ga0207939_102107123300020536FreshwaterQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPSEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208089_101940723300020543FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208360_102358723300020551FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPIEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR
Ga0207940_104092713300020552FreshwaterERNGVVFLSSIPSRKMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208855_105297023300020553FreshwaterNKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR
Ga0207934_107128523300020561FreshwaterVRTERNGVVFLSSIPSRKIQKKQKRPRSNNKPKLMPISKEIGAVELLVFDESTYARRSKAAITTNEIAVRIFSLRVHVKAATSESVRLLLFA
Ga0208718_104778823300020565FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208221_104790023300020574FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSSRVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208053_103785713300020575FreshwaterMQKKQKRPRSSKSPKLTTIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0214162_107217213300021108FreshwaterLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVIRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0214168_111400023300021140FreshwaterKSPKLTPIKSEIGAVELLVFDERTNAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0222714_1055032813300021961Estuarine WaterRNGVVFLSSIPSRKMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR
Ga0222713_1023529013300021962Estuarine WaterIPIKSEIGAVALLVFEERINAVSRSAAMTANEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPKWFQRC
Ga0222712_1044015223300021963Estuarine WaterKKQKRPRSSNRPRLMPIRSEMGAVELLTLEERMNAVRSKAAITAKEIAVRIFSARVHAEAATPGLPELLLCV
Ga0256299_102346513300024533FreshwaterLTPIKSEIGAVELLVFDERINAVIRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0255294_105550523300024544FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0256306_107481913300024560FreshwaterGPKLTPIKSEIGAVELLVFDERINAVTRSAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR
Ga0256337_103310313300024573FreshwaterNNPKLIPIRSDIGAVELLVFDERIKAMRRRVAITPKEIAVRIFSARVHAEAATPEAPRLLLCCGFIEITLLPK
Ga0255275_107379013300024574FreshwaterPVAIATSTDSNGVVFLSSIPSRKMQKKQKRPRSSNNPKLIPIRSDIGAVELLVFDERIKAMKRRVAITPKEIAVRIFSARVHAEAATPEAPRLLLCCGFIEITLLPK
Ga0255295_110111923300024852FreshwaterRKMQKKQKRPRSSKSPKLIPIKSGIGAVALLVFEERINAVSRSAAITANEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0209413_101342723300025170FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAARRSAAITPKETAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208424_102695413300025445AqueousINGVVFLSSIPSRKMQKKQKRPRSSNRPRLIPIRSEIGAVELLTLEERINAVKSKAAITAKEIAVRIFSARVHAEAATPGLPELLLCV
Ga0208147_103908513300025635AqueousIQKKQKRPRSSNRPRLIPIRREIGAVELLTLEERINAVKSKAAITAKEIAVRIFSARVHAEAATPGLPELLLCV
Ga0208916_1030242313300025896AqueousKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0256300_100632923300026425FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVTRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208443_107721523300027084EstuarineMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEVAAPMVLGLLLCCGLIEITLLPR
Ga0208009_100201353300027114Deep SubsurfaceMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEIMLLPR
Ga0255083_102829923300027153FreshwaterLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0255081_102032213300027155FreshwaterTERKGVAFLSSIPSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208167_106992023300027219EstuarineMPSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEVAAPMVLGLLLCCGLIEITLLPR
Ga0208025_101444623300027225EstuarineKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208929_102575013300027227EstuarineSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208442_105974813300027229EstuarineSTERKGVAFLSSIPSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEVAAPMVLGLLLCCGLIEITLLPR
Ga0208173_102539423300027244EstuarineVAIATSTERNGVAFLSSIPSRKMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208310_104636913300027250EstuarineKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0208027_104085523300027260EstuarineSSKSPKLIPIKSEIGAVELLVFDERINAMSKREAITPNEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR
Ga0209617_1025149613300027720Freshwater And SedimentLTPIKSEIGAVELLVFDERINAARRSAAITPKETAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0209770_1005136213300027769Freshwater LakeIATSTERNGVVFLSSIPSRKMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0255254_102321113300028105FreshwaterPKLTPIKSEIGAVELLVFDERTNAVRRRAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0255234_104228313300028113FreshwaterALEQEPQADTNESEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0315899_1131834323300031784FreshwaterMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVSRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0315909_1029352823300031857FreshwaterSSIPSRKMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSSRVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0315903_1046423323300032116FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVIRSAAITPKETAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0334982_0302251_35_2893300033981FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0334979_0012811_67_3513300033996FreshwaterMAVRTERNGVVFLSSIPSRKIQKKQKRPRSKSKPKLMPISKEIGAVELLVFDESTYARRSKAAITTKEIAVRIFSLRVHVKAATSESVRLLLFA
Ga0334986_0441133_222_4763300034012FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0335005_0186314_426_6803300034022FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR
Ga0334995_0667130_241_4953300034062FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0335012_0131580_1090_13443300034093FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAARRSAAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0335025_0668902_221_4753300034096FreshwaterMQKKQKRPRSSKSPKLIPIKSEIGAVELLVFDERINAVRRRAAITPNEIAVRIFSARVQAEAAAPMALGLLLCCGLIEITLLPR
Ga0335027_0817868_40_3243300034101FreshwaterVFLSSIPSRKIQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVSKREAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR
Ga0335063_0548976_36_3203300034111FreshwaterMAVRTERNGVVFLSSIPSRKIQKKQKRPRSNNKPKLMPISKEIGAVELLVFDESTYERRSKAAITTNEIAVRIFSLRVHVKAATSESVRLLLFA
Ga0335053_0420042_340_5943300034118FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGTVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0334997_0606205_76_3303300034280FreshwaterMQKKQKRPRSSKSPKLTPIKSEIGAVELLVFDERINAVIRSAAITPNEIAVRIFSARVQAEAAAPMVLGLLLCCGLIEITLLPR
Ga0335013_0776229_2_2443300034284FreshwaterQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVSKREAITPKEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR
Ga0335039_0153250_612_8663300034355FreshwaterMQKKQKRPRSSNSPKLTPIKSEIGAVELLVFDERINAVRRSAAITPNEIAVRIFSARVQAEAAAPIVLGLLLCCGLIEITLLPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.