NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088326

Metagenome / Metatranscriptome Family F088326

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088326
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 54 residues
Representative Sequence LSDRHATGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRSPAGASQAIWIRQIAGMM
Number of Associated Samples 100
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.08 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.165 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(20.183 % of family members)
Environment Ontology (ENVO) Unclassified
(55.963 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.202 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.61%    β-sheet: 9.64%    Coil/Unstructured: 86.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00156Pribosyltran 58.72
PF06480FtsH_ext 14.68
PF00933Glyco_hydro_3 1.83
PF00296Bac_luciferase 0.92
PF01702TGT 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 14.68
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 1.83
COG0343Queuine/archaeosine tRNA-ribosyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.92
COG1549Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domainsTranslation, ribosomal structure and biogenesis [J] 0.92
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.17 %
UnclassifiedrootN/A1.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001546|JGI12659J15293_10006867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3298Open in IMG/M
3300002245|JGIcombinedJ26739_100200802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1885Open in IMG/M
3300002245|JGIcombinedJ26739_100251974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1653Open in IMG/M
3300004092|Ga0062389_100640519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1231Open in IMG/M
3300005555|Ga0066692_10532400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300005591|Ga0070761_11025146All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006028|Ga0070717_10457476All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300006162|Ga0075030_101074434All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300007265|Ga0099794_10032950All Organisms → cellular organisms → Bacteria2434Open in IMG/M
3300009524|Ga0116225_1557066All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009615|Ga0116103_1050125All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300009623|Ga0116133_1234230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7500Open in IMG/M
3300009629|Ga0116119_1128789All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300009632|Ga0116102_1017508All Organisms → cellular organisms → Bacteria2520Open in IMG/M
3300009634|Ga0116124_1013926All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300009634|Ga0116124_1117736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300009634|Ga0116124_1233800All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300009643|Ga0116110_1158951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300009759|Ga0116101_1033814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300009760|Ga0116131_1209132All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300009762|Ga0116130_1303803All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300009764|Ga0116134_1213524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7670Open in IMG/M
3300009824|Ga0116219_10166037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1272Open in IMG/M
3300009824|Ga0116219_10455264All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300009839|Ga0116223_10154642All Organisms → cellular organisms → Bacteria → Acidobacteria1422Open in IMG/M
3300012199|Ga0137383_11201905All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012203|Ga0137399_10345906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1234Open in IMG/M
3300012359|Ga0137385_11035290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7677Open in IMG/M
3300012361|Ga0137360_10728802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300014152|Ga0181533_1242966All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300014159|Ga0181530_10133531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1435Open in IMG/M
3300014492|Ga0182013_10127577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1650Open in IMG/M
3300014498|Ga0182019_10328882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71026Open in IMG/M
3300014501|Ga0182024_10639613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1324Open in IMG/M
3300016705|Ga0181507_1262868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1092Open in IMG/M
3300017823|Ga0187818_10140967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1048Open in IMG/M
3300017928|Ga0187806_1332311All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300017933|Ga0187801_10332341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300017934|Ga0187803_10409987Not Available550Open in IMG/M
3300017938|Ga0187854_10190906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300017941|Ga0187850_10485243All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300017942|Ga0187808_10354397All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300017946|Ga0187879_10218091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71067Open in IMG/M
3300018002|Ga0187868_1268378All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300018012|Ga0187810_10035973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1833Open in IMG/M
3300018013|Ga0187873_1216937All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300018014|Ga0187860_1134128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300018016|Ga0187880_1386635All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300018019|Ga0187874_10140286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1028Open in IMG/M
3300018021|Ga0187882_1414632All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300018024|Ga0187881_10389131All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300018025|Ga0187885_10279306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300018030|Ga0187869_10311138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300018033|Ga0187867_10623553All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300018037|Ga0187883_10102412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1487Open in IMG/M
3300018037|Ga0187883_10593323All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300018040|Ga0187862_10279978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1060Open in IMG/M
3300018042|Ga0187871_10167379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1237Open in IMG/M
3300018043|Ga0187887_10908120All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300018047|Ga0187859_10355560All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300018057|Ga0187858_10055754All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2817Open in IMG/M
3300018057|Ga0187858_10410899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300019278|Ga0187800_1246382All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300019787|Ga0182031_1390320All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300019788|Ga0182028_1306198Not Available1674Open in IMG/M
3300019888|Ga0193751_1092499All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300021168|Ga0210406_10236022All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300021420|Ga0210394_10779952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300021477|Ga0210398_10548198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium940Open in IMG/M
3300021477|Ga0210398_11516381All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300021559|Ga0210409_10796875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300021559|Ga0210409_11291494All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300022521|Ga0224541_1020054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300022533|Ga0242662_10014968All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300025442|Ga0208034_1059469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7755Open in IMG/M
3300025448|Ga0208037_1006976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3483Open in IMG/M
3300025474|Ga0208479_1049490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300025500|Ga0208686_1011844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2417Open in IMG/M
3300025576|Ga0208820_1069102All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300025579|Ga0207927_1114473All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300026271|Ga0209880_1074758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300026557|Ga0179587_10120696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1608Open in IMG/M
3300026920|Ga0208575_1017290All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300027394|Ga0209904_1002248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1518Open in IMG/M
3300027546|Ga0208984_1059390All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300027651|Ga0209217_1144533All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300027692|Ga0209530_1116654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300027729|Ga0209248_10043097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1392Open in IMG/M
3300027737|Ga0209038_10024241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1790Open in IMG/M
3300027783|Ga0209448_10096721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300027812|Ga0209656_10224146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300027905|Ga0209415_10862154All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300028069|Ga0255358_1069076All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300028268|Ga0255348_1030956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300029817|Ga0247275_1091545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300029817|Ga0247275_1158739All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300029939|Ga0311328_10842980All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300029953|Ga0311343_11013073All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300029999|Ga0311339_10803663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300030659|Ga0316363_10414911All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300030706|Ga0310039_10306628All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300030707|Ga0310038_10295898All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300031247|Ga0265340_10551336All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031708|Ga0310686_105346263All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031720|Ga0307469_10045121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2718Open in IMG/M
3300033433|Ga0326726_11079158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300033887|Ga0334790_179450All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300034163|Ga0370515_0008303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5000Open in IMG/M
3300034282|Ga0370492_0166963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland20.18%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland14.68%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.50%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.59%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.83%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.83%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.83%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.92%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.92%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026920Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes)EnvironmentalOpen in IMG/M
3300027394Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3DEnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12659J15293_1000686743300001546Forest SoilELLSDRHATGVQKKLWPVAVAEDCGLIWMRDFAVPAAFRSPADATQAIWIRELPA*
JGIcombinedJ26739_10020080213300002245Forest SoilLSDRHATGVQKKLWPVAVAEDCGLIWMRDFAVPAAFRSPADATQAIWIRELPA*
JGIcombinedJ26739_10025197433300002245Forest SoilLVAVANGCGLIWMRGFAVPAAFKPPPEASKAIWIRELRP*
Ga0062389_10064051913300004092Bog Forest SoilVTGAEKKLWPVAIAEGCGLVWMRGFAVPAIFRAPAGTPKAIWIREI*
Ga0066692_1053240023300005555SoilVKELLTDRHATGAEKKLWPVAVAKGCGLIWMRGFAVPAAFQAPAGASKAIWIREIAGMM*
Ga0070761_1102514613300005591SoilLLSDRHATGAEKKLWPVAVAEGSGLVWMRGFAVPAAFRASAGALKAIWIREIAGMM*
Ga0070717_1045747613300006028Corn, Switchgrass And Miscanthus RhizosphereGAEKKLWPVAEAEGCGIIWMRGFAAPAAFRAPAGSAKAIWIRETATVI*
Ga0075030_10107443423300006162WatershedsLLSDRHAAGAEKKLWPVAVRRGDLVWMRGFAAPAAVRAPERAEKAIWIREIEGML*
Ga0099794_1003295013300007265Vadose Zone SoilDRFQPAHTPAAKKVKELLTDRHATGAEKKLWPVAVAEGCGLIWMRGFAVPAAFQTPAGASKAIWIREVAGMM*
Ga0116225_155706623300009524Peatlands SoilGAEKKLWPVAVAEGCGLVWMRGFAVPAAWEAPAGASMAIWIREIEGMM*
Ga0116103_105012533300009615PeatlandTATGKKVKELLSDRHAIGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPAGARKAIWIREMAGMM*
Ga0116133_123423023300009623PeatlandTATEKKVKELLSDRHATGAVKKLWPVAVAEDCGLVWMRGFAVPAAFRAPAGAGHAIWIREIASMM*
Ga0116119_112878923300009629PeatlandLWPVAVAEGCGLLWMRGFAVPAAFRAPAGASKAIWIREMADMM*
Ga0116102_101750813300009632PeatlandPVAIAEGCGLVWMRGFAVPAAFRSPPGASQAIWIRQIAGMM*
Ga0116124_101392633300009634PeatlandGSEKKLWPVAVAEGCGLVWMRGFAVPAAFRAAAGASQAIWIREIARMM*
Ga0116124_111773623300009634PeatlandAEGCGLVWMRGFAVPAAFRSPPGASQAIWIRQIAGMM*
Ga0116124_123380023300009634PeatlandHAAGAEKKLWPVAVAEGGGLVWMRGFAVPAAFRAPAGASKAIWIREIAGMM*
Ga0116110_115895123300009643PeatlandEKKLWPVAVAEGGGLVWMRGFAVPAAFRAPAGASKAIWIREIAGMM*
Ga0116101_103381413300009759PeatlandATEKKVKELLSDRHATGAVKKLWPVAVAEDCGLVWMRGFAVPAAFRAPAGAGHAIWIREIASMM*
Ga0116131_120913223300009760PeatlandPVAVAAGCGLVWMRGFAVPVAFRAPAGASQAIWIREIAGMM*
Ga0116130_130380313300009762PeatlandAAKKVKELLSDRHATGAQKKLWPVAVAAGCGLVWMRGFAVPADWRAPAGASKAIWIREIAGMM*
Ga0116134_121352423300009764PeatlandAEGCGLVWMRGFAVPAAFRSPAGALQAIWIREIAGMM*
Ga0116219_1016603713300009824Peatlands SoilELLSDRHATGAEKKLWPVAVAEGCGLIWMRGFAVPAAFRAPAGASRAIWVRETTGMM*
Ga0116219_1045526413300009824Peatlands SoilASAKKVKELLSDRHAVGAEKKRWPVAVAEGCGLVWMRGFAVPAAWEAPAGASKAIWIREIEGMM*
Ga0116223_1015464233300009839Peatlands SoilPSHTSSAKKVKELLSGRHLTGAEKKLWPVAVVKGRGLIWMRGFAVPAAFRAPVGASQAIWIREIAGMM*
Ga0137383_1120190523300012199Vadose Zone SoilCGLIWMRGFAVPAAFQTPAGASKAIWIREVAGMM*
Ga0137399_1034590613300012203Vadose Zone SoilEKKLWPVAVAEGCGLIWMRGFAVPAAFHASAEASKAIWIREIAAMM*
Ga0137385_1103529023300012359Vadose Zone SoilDRQVTGVEKKLWPVAAAEGCGLIWMRGFAVPAAFQTPAGASKAIWIREVAGMM*
Ga0137360_1072880223300012361Vadose Zone SoilGTEKKLWPVAEAEGCGIIWMRGFAAPAAFRAPAGSAKAVWIRETATVI*
Ga0181533_124296623300014152BogGAEKKLWPVAVAEGCGLVWMRGFAVPAVFRAPAGARKAIWIREMADMM*
Ga0181530_1013353133300014159BogAHTAAARKVKELLSDRHATGEEKKLWPVAIAEGCGLVWMRGFAVPAAFRSPPGASQAIWIRQIAGMM*
Ga0182013_1012757713300014492BogDRHATGAQKKLWPVAEAEGCGLVWMRGFPVPAAWRAPAAALRAIWIREIAGMM*
Ga0182019_1032888223300014498FenDRHATGAEKKLWPVAVAEGCGLIWMRGFAVPAAFRAPAGASKAIWIREIAG*
Ga0182024_1063961313300014501PermafrostVAEGGEIVWMSGFAVPSAFRARDGATEAIWIREIAGMM*
Ga0181507_126286833300016705PeatlandDRYWPSYTAAARKVKELLSDRHATGAEKKLWPVAVAEGCGLVWVRGFAVPAAFRAPAGTSKAIWIREIAAMM
Ga0187818_1014096713300017823Freshwater SedimentKLWPVAVAAGYGIVWMRGFAVPAAFRAPAGAAKAIWIREIAGMM
Ga0187806_133231123300017928Freshwater SedimentLSDRHATGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRSPAGASQAIWIRQIAGMM
Ga0187801_1033234113300017933Freshwater SedimentWPVAVAEGHGIVWMRGFAVPAAFRAPVGAPQAIWIREIAGMM
Ga0187803_1040998713300017934Freshwater SedimentLLADRRISGMERKLWPVAVAEGVGLVWVRGFAVPAGLQSPPGASAALWIRESPCAAVSRK
Ga0187854_1019090613300017938PeatlandKVKELLSGRHATGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPAGAPQAIWIREIAGMM
Ga0187850_1048524323300017941PeatlandEGCGLVWMRGFAVPAAFRAPAGAPQAIWIREIAGMM
Ga0187808_1035439723300017942Freshwater SedimentTGAKKKLWPVAVKEDGSLVWMRGFAAPAAIAARATGKAIWMRELGTSP
Ga0187879_1021809123300017946PeatlandAVAEGCGIVWMRGFAVPAIFRASAGAAQAISIRETDGMM
Ga0187868_126837823300018002PeatlandWPAHRAAARKVKELLSDRHATGAQKKLWPVAIAEGCGLVWMRGFAVPAAFRAAAGASKAIWIREIAGMM
Ga0187810_1003597333300018012Freshwater SedimentVKDLLSGRHATGAEKKLWPVAVAEGHGIVWMRGFAVPAAFRAPVGAPQAIWIREIAGMM
Ga0187873_121693713300018013PeatlandKKVKELLSDRHAIGAEKKLWPVAVAEGCGLLWMRGFAVPAAFRAPAGASKAIWIREMADM
Ga0187860_113412823300018014PeatlandYWPAHTAAAKKVKELLSDRHATGSEKKLWPVAVAEGCGLVWMRGFAVPAAFRAAAGASQAIWIREIARMM
Ga0187880_138663513300018016PeatlandAGCGLVWMRGFAVPVAFRAPAGASQAIWIREIAGMM
Ga0187874_1014028623300018019PeatlandGDRHATGAEKKLWPVAVAAGCGLVWMRGFAVPVAFRAPAGASQAIWIREIAGMM
Ga0187882_141463223300018021PeatlandAARKVKELLSDRHATGAQKKLWPVAVAAGCGLVWMRGFAVPAAFQAAAGASKAIWIREIAGMM
Ga0187881_1038913123300018024PeatlandAEKKVKKLLSDRHATGAEKKLWPVAFAEGCGLVWMRGFPVPAAFRSPAGALQAIWIREIAGMM
Ga0187885_1027930623300018025PeatlandHTAAARKVKELLSDRHATGAEKKLWPVAIAEGCGLVWMRGFAVPVAYRAPAGAPRAIWIRQIAGMM
Ga0187869_1031113813300018030PeatlandELLSDRHATGEEKKLWPVAFAAGFGLVWMRGFAVPEAFRSPPGASQAIWIREIVGMM
Ga0187867_1062355323300018033PeatlandAHTAAAKKVKELLSDRHATGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPTGAAQAIWIREIAGMM
Ga0187883_1010241213300018037PeatlandHTASAKKVKELLSDRHAAGAEKKLWPVAVAEGGGLVWMRGFAVPAAFRAPAGASKAIWIREIAGMM
Ga0187883_1059332323300018037PeatlandKVKELLSDRHATGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPAGASKAICIREIAGMM
Ga0187862_1027997813300018040PeatlandVKELLGDRHAAGAEKKLWPVAVAEGCGLVWMRGFAVPAVFRASAGASKAIWIREITGMM
Ga0187871_1016737913300018042PeatlandLLSDRHATGAVKKLWPVAVAEDCGLVWMRGFAVPAAFRAPAGAGHAIWIREIASMM
Ga0187887_1090812013300018043PeatlandKVKELLSDRHATGVQKKLWPVAVAECRGLVWMRGFAVPAAFRAPAGAAQAIWIRETAGMM
Ga0187859_1035556023300018047PeatlandLLGDRHATGTEKKLWPVAVAEDGGLVWMRGFAAPEAVRARTGKAIWIREIENPEVR
Ga0187858_1005575413300018057PeatlandKLWPVAVAEGCGLVWMRGFAVPAAFRAPAEASKAIWIREIAGMM
Ga0187858_1041089913300018057PeatlandRKVKELLSDRHATGAEKKLWPVAIAEGCGLVWMRGFAVPAAFRSPAGASQAIWIRQIAGM
Ga0187800_124638213300019278PeatlandSAEKKVKELLGDRHASGAEKKRWPVAAAEGQGIVWMRGFAVPAALRAPEGAAQAIWIREIAGMM
Ga0182031_139032023300019787BogKGKGVAGDRHATGARKKLWPVATAEGCGLVWVRDFAAPAAFQAPPGAAQAIWIREIGL
Ga0182028_130619823300019788FenVIASGQRTHRGKKGEELLSDRHATGAQKKLWPVAEAEGCGLVWMRGSQFRRLRAPAAALRAIWIREIAA
Ga0193751_109249913300019888SoilMMGAEKKLWPVAEAEGCGIIWMRGFAAPAAFRAPAGSAKAIWIRETATVI
Ga0210406_1023602213300021168SoilKKLWPVAVAKGCGLIWLRGFAVPAAFRSSVGASRAIWIRQIAGMM
Ga0210394_1077995223300021420SoilTGREKKLWPVAVAKGCGLIWMRGFAVPAAFRSSVGASKAIWIRQIAGMM
Ga0210398_1054819823300021477SoilRHVTGGEKKLWPVAVAEGRGLVWMRGFAVPASLRAPAGASRAIWIREIAGMM
Ga0210398_1151638123300021477SoilLLSDRHVTGAEKKLWPVAIAEGCGIIWMRGFSVPAAFQTNPEAAKAIWIREIACMM
Ga0210409_1079687523300021559SoilAEKKLWPVAVAKGCGLIWMRGFAVPAAFQAPAGAARAIWIREIAGMM
Ga0210409_1129149413300021559SoilRFWPAHTAAEKKVKELLSDRHATGREKKLWPVAVAKGCGLIWLRGFAVPAAFRSSVGASKAIWIRQIAGMM
Ga0224541_102005413300022521SoilSDRHATGATKKMWPVAVGRGDLVWMRGFPVSAAVRAPAGAEKAVWIRELRP
Ga0242662_1001496813300022533SoilEKKLWPVAVAKGCGLIWMRGFAVPAAFRSSVGASKAIRIRQIAGMM
Ga0208034_105946913300025442PeatlandAGKKVKELLSDRHAIGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPAGARKAIWIREMAGMM
Ga0208037_100697633300025448PeatlandKKVKELLSDRHAIGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPAGARKAIWIREMAGM
Ga0208479_104949013300025474Arctic Peat SoilPVAFAEGCGLIWMRGFVAPAVFRAPAGASKAIWIREIAGMM
Ga0208686_101184413300025500PeatlandAKKVKELLSDRHATGAEKKLWPVAVAEGCGLVWVRGFAVPAAFRAPAGAAKAIWIREIAGMM
Ga0208820_106910213300025576PeatlandKLWPVAIAEGCGLVWMRGFAVPVAYRAPAGAPRAIWIRQIAGMM
Ga0207927_111447323300025579Arctic Peat SoilRYWPAHTAAVKKVKELLSDRHATGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRATEGASRAIWIRETAGMM
Ga0209880_107475823300026271SoilLWPVAVAEGCGLVWMRGFAVPAGFRAPAGASKAIWIREIAGMM
Ga0179587_1012069633300026557Vadose Zone SoilELLSDRHATGAEKKLWPVAVAEGCGIVWIRGFPVPAAFRAPMRTPKAIWIREVTGMM
Ga0208575_101729013300026920SoilAAAKKVKELLSDRHATGVEKKLWPVAVAKGCGLIWMRGFAVPAAFRSSVGASKAIWIRQIAGMM
Ga0209904_100224833300027394Thawing PermafrostLLTERHATGAEKKLWPVASAAGCGLVWMRGFAIPAAFRAPAGAAQAIWIREIAGMM
Ga0208984_105939013300027546Forest SoilAHTAATKKVKELLSDRHATGAQKKLWPVAVAEGCGLIWMRGFAVPAAFRASAGASKAIWIRELRA
Ga0209217_114453313300027651Forest SoilRHATGVEKKLWPVAVAEGCGLIWMRGFAVPAAFQAPAGASQAIWIRELRP
Ga0209530_111665423300027692Forest SoilSDRHATGAQKKLWPVADAEGCGLIWLRGFAVPKAFRAPAGARQAIWIREIASLM
Ga0209248_1004309733300027729Bog Forest SoilAEKKLWPVAVAEGCGLIWMRGFAVPVALRASHDASRAIWIREIAGMM
Ga0209038_1002424113300027737Bog Forest SoilKELLSDRHATGTEKKLWPVAVARGDLIWMRGFAVPASVRAPEGATQAIWIRELRA
Ga0209448_1009672113300027783Bog Forest SoilLLSDRHATGAEKKLWPVAAAEGCGLVWMRGFTVPPALRAPAGAAKAIWIREIAGMM
Ga0209656_1022414613300027812Bog Forest SoilQKKLWPVAVAEGCGLVWMRGFAVPADFRALSGAAKAIWIREIAGMM
Ga0209415_1086215423300027905Peatlands SoilDRHATGAEKKLWPVAVAAGYGLVWLRGFAVPAAFRSPAGALKAICIREIAGMM
Ga0255358_106907613300028069SoilHATGAEKKLWPVAVAEGCGLIWMRGFAVPAAFRAPAGASKAIWIREIAG
Ga0255348_103095623300028268SoilATGARKKLWPVATAEGCGLVWVRDFAAPAAFQAPPGAAQAIWIREIGL
Ga0247275_109154513300029817SoilGCGLVWMRGFAVPAAFRAPAGAPQAIWIREIAGMM
Ga0247275_115873913300029817SoilLWPVAVAEGGGLVWMRGFAVPAAFRAPAGASKAIWIREIAGMM
Ga0311328_1084298013300029939BogKVKELLSDRHATGAEKKLWPVAVAEGGEIVWMSGFAVPSAFRARDGATEAIWIREIAGMM
Ga0311343_1101307313300029953BogKVKELLSDRHATGAQKKLWPVAVAEGGEIVWMSGFAVPSAFRARDGATEAIWIREIAGMM
Ga0311339_1080366323300029999PalsaEKKLWPVAFADGCGLVWMRGFAVPAAFQPHADSTRAIWIRQTAGMM
Ga0316363_1041491123300030659Peatlands SoilWPVAVAEGCGLVWMRGFAVPAAFRSPAGASQAIWIRQIAGMM
Ga0310039_1030662813300030706Peatlands SoilASAKKVKELLSDRHAVGAEKKRWPVAVAEGCGLVWMRGFAVPAAWEAPAGASKAIWIREIEGMM
Ga0310038_1029589813300030707Peatlands SoilFWPAHTAAARKVKELLSDRHATGAEKKLWPVAIAEGCGLVWMRGFAVPAALRSPAGASQAIWIREIAGMM
Ga0265340_1055133623300031247RhizosphereGAWKKLWPVAVAEGCGLIWMRGFAVPAAFRAPAGASKAIWIREIAG
Ga0310686_10534626313300031708SoilHTAAAKKVKELLSDHHATGMEKKLWPVAVAKGCGLVWMRGFAVPAALRAPAQASKAILIREIAGMM
Ga0307469_1004512133300031720Hardwood Forest SoilPAHTAAAKKVKELLTARHVTGTQKKLWPVAVAEGCGIVWMRGFSAPAAFSAPAAASQAIWIREIAGIM
Ga0326726_1107915813300033433Peat SoilGRHLTGREKKLWPVVAAEGMGLVWMRGFPVPDALRSAAGAGLVIWIRETLVA
Ga0334790_179450_2_1543300033887SoilSTGAEKKLWPVAVAEGCGLVWMRGFAVPAAFRAPTGAAQAIWIREIAGMM
Ga0370515_0008303_4826_49993300034163Untreated Peat SoilKVKDLLSDRHATGATKKMWPVAVGRGDLVWMRGFPVSAAVRAPAGAEKAVWIRELRP
Ga0370492_0166963_3_1703300034282Untreated Peat SoilELLSDRHSTGVEKKLWPVAVVEGCELVWMRGFAVPEAFRAPPGAAKAIWIREIAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.