| Basic Information | |
|---|---|
| Family ID | F088226 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 38 residues |
| Representative Sequence | HLSDAVRLSRIEQDALRRSGLAGIDVGHDADVPATF |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.75 % |
| % of genes near scaffold ends (potentially truncated) | 90.83 % |
| % of genes from short scaffolds (< 2000 bps) | 85.32 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.550 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.018 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.275 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.119 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00177 | Ribosomal_S7 | 69.72 |
| PF00164 | Ribosom_S12_S23 | 19.27 |
| PF00009 | GTP_EFTU | 2.75 |
| PF14492 | EFG_III | 1.83 |
| PF03764 | EFG_IV | 0.92 |
| PF14559 | TPR_19 | 0.92 |
| PF00378 | ECH_1 | 0.92 |
| PF12706 | Lactamase_B_2 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0049 | Ribosomal protein S7 | Translation, ribosomal structure and biogenesis [J] | 69.72 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.55 % |
| All Organisms | root | All Organisms | 39.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004121|Ga0058882_1824921 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005177|Ga0066690_10152096 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300005332|Ga0066388_107860149 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005467|Ga0070706_100811252 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005542|Ga0070732_10259260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1041 | Open in IMG/M |
| 3300005591|Ga0070761_10023321 | All Organisms → cellular organisms → Bacteria | 3451 | Open in IMG/M |
| 3300008785|Ga0103638_1001831 | Not Available | 646 | Open in IMG/M |
| 3300009012|Ga0066710_104822905 | Not Available | 504 | Open in IMG/M |
| 3300009088|Ga0099830_10118745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1999 | Open in IMG/M |
| 3300009090|Ga0099827_10045899 | Not Available | 3260 | Open in IMG/M |
| 3300009137|Ga0066709_100143326 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300009137|Ga0066709_102499646 | Not Available | 697 | Open in IMG/M |
| 3300009137|Ga0066709_104221181 | Not Available | 523 | Open in IMG/M |
| 3300009143|Ga0099792_10590059 | Not Available | 707 | Open in IMG/M |
| 3300009143|Ga0099792_10834219 | Not Available | 606 | Open in IMG/M |
| 3300009547|Ga0116136_1135358 | Not Available | 628 | Open in IMG/M |
| 3300009631|Ga0116115_1032972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300009633|Ga0116129_1003707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7250 | Open in IMG/M |
| 3300009639|Ga0116122_1175325 | Not Available | 676 | Open in IMG/M |
| 3300009639|Ga0116122_1190843 | Not Available | 643 | Open in IMG/M |
| 3300009644|Ga0116121_1000075 | All Organisms → cellular organisms → Bacteria | 52366 | Open in IMG/M |
| 3300009645|Ga0116106_1158319 | Not Available | 724 | Open in IMG/M |
| 3300009645|Ga0116106_1191720 | Not Available | 651 | Open in IMG/M |
| 3300009665|Ga0116135_1313596 | Not Available | 621 | Open in IMG/M |
| 3300009700|Ga0116217_10103420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1946 | Open in IMG/M |
| 3300009764|Ga0116134_1010584 | All Organisms → cellular organisms → Bacteria | 3985 | Open in IMG/M |
| 3300009764|Ga0116134_1047234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
| 3300009824|Ga0116219_10336262 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300009839|Ga0116223_10005074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11210 | Open in IMG/M |
| 3300009839|Ga0116223_10145132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1476 | Open in IMG/M |
| 3300009839|Ga0116223_10580730 | Not Available | 648 | Open in IMG/M |
| 3300010047|Ga0126382_12394190 | Not Available | 512 | Open in IMG/M |
| 3300010096|Ga0127473_1055917 | Not Available | 594 | Open in IMG/M |
| 3300010325|Ga0134064_10070438 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300010333|Ga0134080_10020639 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300010341|Ga0074045_10616936 | Not Available | 691 | Open in IMG/M |
| 3300010359|Ga0126376_11171513 | Not Available | 781 | Open in IMG/M |
| 3300010379|Ga0136449_102786844 | Not Available | 691 | Open in IMG/M |
| 3300010379|Ga0136449_103861462 | Not Available | 563 | Open in IMG/M |
| 3300010401|Ga0134121_10081758 | Not Available | 2687 | Open in IMG/M |
| 3300010876|Ga0126361_10917828 | Not Available | 941 | Open in IMG/M |
| 3300011058|Ga0138541_1013891 | Not Available | 512 | Open in IMG/M |
| 3300011065|Ga0138533_1083254 | Not Available | 778 | Open in IMG/M |
| 3300011082|Ga0138526_1185922 | Not Available | 590 | Open in IMG/M |
| 3300011088|Ga0138576_1104536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300011120|Ga0150983_10138378 | Not Available | 672 | Open in IMG/M |
| 3300011120|Ga0150983_13602782 | Not Available | 1494 | Open in IMG/M |
| 3300011120|Ga0150983_14109216 | Not Available | 659 | Open in IMG/M |
| 3300011269|Ga0137392_10714494 | Not Available | 829 | Open in IMG/M |
| 3300011269|Ga0137392_11145992 | Not Available | 635 | Open in IMG/M |
| 3300012189|Ga0137388_11667002 | Not Available | 572 | Open in IMG/M |
| 3300012189|Ga0137388_11687241 | Not Available | 568 | Open in IMG/M |
| 3300012198|Ga0137364_10379602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1056 | Open in IMG/M |
| 3300012200|Ga0137382_10647675 | Not Available | 756 | Open in IMG/M |
| 3300012200|Ga0137382_11151201 | Not Available | 553 | Open in IMG/M |
| 3300012202|Ga0137363_10079688 | Not Available | 2436 | Open in IMG/M |
| 3300012202|Ga0137363_11026021 | Not Available | 701 | Open in IMG/M |
| 3300012212|Ga0150985_109032676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1614 | Open in IMG/M |
| 3300012349|Ga0137387_10462493 | Not Available | 921 | Open in IMG/M |
| 3300012349|Ga0137387_10863088 | Not Available | 655 | Open in IMG/M |
| 3300012356|Ga0137371_10145291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1859 | Open in IMG/M |
| 3300012357|Ga0137384_11264885 | Not Available | 584 | Open in IMG/M |
| 3300012363|Ga0137390_11402718 | Not Available | 643 | Open in IMG/M |
| 3300012363|Ga0137390_11684973 | Not Available | 569 | Open in IMG/M |
| 3300012375|Ga0134034_1157825 | Not Available | 619 | Open in IMG/M |
| 3300012469|Ga0150984_106550063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1192 | Open in IMG/M |
| 3300012486|Ga0157331_1002898 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012582|Ga0137358_10743595 | Not Available | 655 | Open in IMG/M |
| 3300012923|Ga0137359_11211928 | Not Available | 643 | Open in IMG/M |
| 3300012923|Ga0137359_11530802 | Not Available | 555 | Open in IMG/M |
| 3300012925|Ga0137419_10823197 | Not Available | 761 | Open in IMG/M |
| 3300012984|Ga0164309_11440124 | Not Available | 588 | Open in IMG/M |
| 3300013306|Ga0163162_10322710 | Not Available | 1677 | Open in IMG/M |
| 3300013306|Ga0163162_12563950 | Not Available | 586 | Open in IMG/M |
| 3300014162|Ga0181538_10525959 | Not Available | 621 | Open in IMG/M |
| 3300014164|Ga0181532_10592802 | Not Available | 602 | Open in IMG/M |
| 3300014200|Ga0181526_10221206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1209 | Open in IMG/M |
| 3300014201|Ga0181537_10128142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1736 | Open in IMG/M |
| 3300014201|Ga0181537_10837925 | Not Available | 623 | Open in IMG/M |
| 3300014489|Ga0182018_10142666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1373 | Open in IMG/M |
| 3300014501|Ga0182024_12501096 | Not Available | 557 | Open in IMG/M |
| 3300014657|Ga0181522_10171611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1271 | Open in IMG/M |
| 3300014658|Ga0181519_10146406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1507 | Open in IMG/M |
| 3300015054|Ga0137420_1404852 | Not Available | 731 | Open in IMG/M |
| 3300015193|Ga0167668_1015012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1739 | Open in IMG/M |
| 3300015193|Ga0167668_1018621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300015372|Ga0132256_101471586 | Not Available | 792 | Open in IMG/M |
| 3300015374|Ga0132255_100074346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4529 | Open in IMG/M |
| 3300017955|Ga0187817_10109903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1739 | Open in IMG/M |
| 3300018026|Ga0187857_10106005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1363 | Open in IMG/M |
| 3300018482|Ga0066669_10941706 | Not Available | 776 | Open in IMG/M |
| 3300019786|Ga0182025_1218659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2015 | Open in IMG/M |
| 3300019786|Ga0182025_1275942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2354 | Open in IMG/M |
| 3300021181|Ga0210388_10733348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
| 3300022712|Ga0242653_1003954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1565 | Open in IMG/M |
| 3300022717|Ga0242661_1001143 | Not Available | 2615 | Open in IMG/M |
| 3300026088|Ga0207641_12635954 | Not Available | 500 | Open in IMG/M |
| 3300026313|Ga0209761_1326720 | Not Available | 523 | Open in IMG/M |
| 3300027050|Ga0209325_1024132 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027911|Ga0209698_10003025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18827 | Open in IMG/M |
| 3300029955|Ga0311342_11079219 | Not Available | 588 | Open in IMG/M |
| 3300031722|Ga0311351_10258131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1318 | Open in IMG/M |
| 3300031954|Ga0306926_10129088 | Not Available | 3122 | Open in IMG/M |
| 3300033829|Ga0334854_071307 | Not Available | 828 | Open in IMG/M |
| 3300033887|Ga0334790_052504 | Not Available | 1512 | Open in IMG/M |
| 3300034124|Ga0370483_0023911 | Not Available | 1822 | Open in IMG/M |
| 3300034125|Ga0370484_0200955 | Not Available | 545 | Open in IMG/M |
| 3300034199|Ga0370514_074910 | Not Available | 857 | Open in IMG/M |
| 3300034644|Ga0370548_004967 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.02% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 10.09% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.09% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.83% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.92% |
| Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058882_18249211 | 3300004121 | Forest Soil | RSAFVHLSDAVRLSRIKQDALRRSGLTGINVRHDADVSAAF* |
| Ga0066690_101520962 | 3300005177 | Soil | AFVHLSDAVRPSRIKQDALRRSGLTGINVRHDADVPTPF* |
| Ga0066388_1078601492 | 3300005332 | Tropical Forest Soil | RSAFVDLSDAMQSSRIEKNALGRSGLTSIDVGHDADVSATI* |
| Ga0070706_1008112522 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AFVHLSDAVRLSRIKQDTLRRSGLTGIDVGHDADIPAAF* |
| Ga0070732_102592603 | 3300005542 | Surface Soil | LSDAVRPSRIKQDALRRSGLSGIDVRHDADVSATL* |
| Ga0070761_100233211 | 3300005591 | Soil | SAFVHLSDAVRLSRIKQDALRRSGLTGIDVGHDADVSATL* |
| Ga0103638_10018311 | 3300008785 | Wetland Soil | GGRAFVHLSDAMRPSRIKQDALRRRGLTGVDVGHDADVSAAF* |
| Ga0066710_1048229051 | 3300009012 | Grasslands Soil | LSDAVRPSGIEEDALSRSGLAGIDVGHDVDISAAI |
| Ga0099830_101187451 | 3300009088 | Vadose Zone Soil | LSDAVRFACIEQDALRRSGLTSIDVGHDADVPATL* |
| Ga0099827_100458992 | 3300009090 | Vadose Zone Soil | MDLSDAVRSAGIEQDALRRSGLTGIDVGHDTDVPATL* |
| Ga0066709_1001433265 | 3300009137 | Grasslands Soil | MDLSDAVRPPGIEKDAFRRSGLTSIDVGHDADIPATV* |
| Ga0066709_1024996461 | 3300009137 | Grasslands Soil | FMDLSDAVRPPGIEKDAFRRSGLTSIDVGHDADIPATV* |
| Ga0066709_1042211812 | 3300009137 | Grasslands Soil | AFVHLSDAVRPSRIKQDALRRSGLPGINVRHDADIPATL* |
| Ga0099792_105900592 | 3300009143 | Vadose Zone Soil | MHLADTVGLSRIKQDALRRRGLPGIDVGHDADIPATL* |
| Ga0099792_108342191 | 3300009143 | Vadose Zone Soil | RAFVDLSDAVRASCIKQDSLRRSGLTGIDVGHDADVPATF* |
| Ga0116136_11353581 | 3300009547 | Peatland | MHLADTVRLSRIKQDALRRRGLPGIDVRHDADVPATF* |
| Ga0116115_10329723 | 3300009631 | Peatland | HLADAVRLSRIKQDALRRRGLPGIDVGHDADVPATL* |
| Ga0116129_10037071 | 3300009633 | Peatland | DLSDAVRASGVKQDALRRSGLTGIDVGHDADIPATL* |
| Ga0116122_11753252 | 3300009639 | Peatland | DGRAFMHLADTVRLSRIKQDALRRRGLPGIDVRHDADVPATL* |
| Ga0116122_11908431 | 3300009639 | Peatland | DGRAFMHLADTVRLSRIKQDALRRRGLPGIDVRHDADVPATF* |
| Ga0116121_100007560 | 3300009644 | Peatland | RAFVHLSDAVRLSRIKQDALRRSGLSGIDVGHDADVSAAF* |
| Ga0116106_11583192 | 3300009645 | Peatland | AFMHLADTVRLSRIKQDALRRRGLPGIDVRHDADVPATL* |
| Ga0116106_11917201 | 3300009645 | Peatland | RAFMHLADTVRLSRIKQDALRRRGLTGIDVGHDADVPATL* |
| Ga0116135_13135961 | 3300009665 | Peatland | LADTVRLSRIKQDALRRRGLPGIDVGHDADVSAAI* |
| Ga0116217_101034203 | 3300009700 | Peatlands Soil | AFMHLADTVRLSRIKQDALRRRGLPGIDVGHDADVPATF* |
| Ga0116134_10105844 | 3300009764 | Peatland | HLADTVRLSRIKQDALRRRGLTGIDVGHNADVPATL* |
| Ga0116134_10472341 | 3300009764 | Peatland | LADTVRLSRIKQDALRRRGLTGIDVGHDADVPATL* |
| Ga0116219_103362621 | 3300009824 | Peatlands Soil | VHLSDAVRPSRIKQDALRRSGLAGIDVGHDADVSAAF* |
| Ga0116223_1000507413 | 3300009839 | Peatlands Soil | HLADTVRLSRIKQDALRRRGLPGIDVGHDADVPATL* |
| Ga0116223_101451323 | 3300009839 | Peatlands Soil | GRAFMHLADTVRLSRIKQDALRRRGLPGIDVGHDADVPATF* |
| Ga0116223_105807302 | 3300009839 | Peatlands Soil | SDAVRLSRIEQDALRRSGLAGIDVGHDADVSAAF* |
| Ga0126382_123941901 | 3300010047 | Tropical Forest Soil | VNLSDAVRAACVEQDALRRSGLTGINVSHDADVPAAL* |
| Ga0127473_10559172 | 3300010096 | Grasslands Soil | FMHLTNAMRNTGIEQDALSRSGLSGIDVGHDADVSATL* |
| Ga0134064_100704381 | 3300010325 | Grasslands Soil | SAFVDLSDAVRSSRIEKDALRRSGLPGIDVGHDADVPAPF* |
| Ga0134080_100206394 | 3300010333 | Grasslands Soil | FVDLSDAVRSSRIEKDALRRSGLPGIDVGHDADVPAPF* |
| Ga0074045_106169361 | 3300010341 | Bog Forest Soil | AFVHLSDAVRLSRIEQDALRRSGLSGINVRHDADIPAAF* |
| Ga0126376_111715131 | 3300010359 | Tropical Forest Soil | LSDAVRPARIKQDALRRSGLAGIDVRHDADIPATL* |
| Ga0136449_1027868441 | 3300010379 | Peatlands Soil | CAFVHLSDAVRLSRIEQDALRRSGLSGINVRHDADVSAAF* |
| Ga0136449_1038614622 | 3300010379 | Peatlands Soil | HLSDAVRPSRIKQDALRRSGLAGIDVGHDADIPAAF* |
| Ga0134121_100817585 | 3300010401 | Terrestrial Soil | AFVDLSDAVRLSRIKQDALGRSGLAGINVGHDPDVSAPF* |
| Ga0126361_109178282 | 3300010876 | Boreal Forest Soil | VHLSDAVRPSRIKQDSLRRSGLAGIDVGHDADIPAAF* |
| Ga0138541_10138912 | 3300011058 | Peatlands Soil | ADTVRLSRIKQDALRRRGLPGIDVGHDTDVPAAF* |
| Ga0138533_10832542 | 3300011065 | Peatlands Soil | LVHLSDAVRLSRIKQDALRRSGLAGIDVGHDADVPAAF* |
| Ga0138526_11859221 | 3300011082 | Peatlands Soil | FMHLADTVRLSRIKQDALRRRGLTGIDVGHDADVPATL* |
| Ga0138576_11045363 | 3300011088 | Peatlands Soil | GRAFMHLADTVRLSRIKQDALRRRGLPGIDVGLDADVPATF* |
| Ga0150983_101383782 | 3300011120 | Forest Soil | ALVHLSDAVRLSRIEQDALRRSGLTGIDVGHDADVSAAF* |
| Ga0150983_136027821 | 3300011120 | Forest Soil | LSDAVRLSRIEQDALRRSGLTGIDVGHDADVPAAF* |
| Ga0150983_141092161 | 3300011120 | Forest Soil | GGSAFVHLSDAVRLSRIKQDALRRSGLTGIDVGHDADVPAAF* |
| Ga0137392_107144941 | 3300011269 | Vadose Zone Soil | FVHLSNAVRLSRIKKDALRRSGLAGINVGHDADVSAAF* |
| Ga0137392_111459922 | 3300011269 | Vadose Zone Soil | MHLADTVRLSRIEQDALRRRGLPGIDVRHDADVPATL* |
| Ga0137388_116670021 | 3300012189 | Vadose Zone Soil | LADTVRLSRIEQDALRRRGLPGIDVRHDADVPATL* |
| Ga0137388_116872411 | 3300012189 | Vadose Zone Soil | FVDLSDAMRLSRIKQDALRRSGLAGIDMGHDADVPATF* |
| Ga0137364_103796023 | 3300012198 | Vadose Zone Soil | AFMDLSDAVRPPGIEKDAFRRSGLTSIDVGHDADIPATV* |
| Ga0137382_106476752 | 3300012200 | Vadose Zone Soil | LSDAVRTACIEQDALRRSGLAGIDVGHDADVPTTL* |
| Ga0137382_111512012 | 3300012200 | Vadose Zone Soil | DLSDAVRSSRIEKDALRRSGLPGIDVGHDADVPAPF* |
| Ga0137363_100796884 | 3300012202 | Vadose Zone Soil | VDLSDAVRPSGIEKDALSRSGLAGVNVRHDADIPAAL* |
| Ga0137363_110260211 | 3300012202 | Vadose Zone Soil | HLADTVRLSRIKQDALRRRGLPGIDVGHDADIPATL* |
| Ga0150985_1090326763 | 3300012212 | Avena Fatua Rhizosphere | AFVDLSDAVRPSGIEKDAFSRSGLAGINVGHDADVSAAL* |
| Ga0137387_104624932 | 3300012349 | Vadose Zone Soil | AFMDLSDAVRSSRIEKDALRRSGLPGIDVGHDADVPAPF* |
| Ga0137387_108630882 | 3300012349 | Vadose Zone Soil | VYFAQPVRLSRIEKDALGRSGLPGVNVRHDADVPAPF* |
| Ga0137371_101452911 | 3300012356 | Vadose Zone Soil | SDAVRPSRIKQDALRRSGLSGIDVRHDADIPATL* |
| Ga0137384_112648851 | 3300012357 | Vadose Zone Soil | LSDAVRPSRIEQDALRRSGLSGINVRHDTDISATL* |
| Ga0137390_114027181 | 3300012363 | Vadose Zone Soil | SAFMHLSDTMRLSRVKQDALGRSGLTSIDVGHDADVPATL* |
| Ga0137390_116849732 | 3300012363 | Vadose Zone Soil | FMHLADTVRLSRIKQDALRRRGLPGIDVGHDADIPATL* |
| Ga0134034_11578252 | 3300012375 | Grasslands Soil | VDLSDAVRPSGIEKDALSRSGLAGINVRHDADIPATL* |
| Ga0150984_1065500631 | 3300012469 | Avena Fatua Rhizosphere | SDTVRPARIKQDALGRSGLTSIDVGHDADIPATL* |
| Ga0157331_10028981 | 3300012486 | Soil | VGEGLVRFGHAVRPARIEQDALSRSGLAGIDVGHDADIPATL* |
| Ga0137358_107435951 | 3300012582 | Vadose Zone Soil | FVDLADAVRAACIKQDSLRGRGLPGIDVRHDADVPATL* |
| Ga0137359_112119281 | 3300012923 | Vadose Zone Soil | LADTVRLSRIKQDALRRRGLTGIDVGHDADVPATF* |
| Ga0137359_115308021 | 3300012923 | Vadose Zone Soil | DLSDAVRSSRIEKDALRRSGLAGIDVGHDADVPAPF* |
| Ga0137419_108231971 | 3300012925 | Vadose Zone Soil | HLSDAVRLSRIEQDALRRSGLPSIDVGHDADVSAAF* |
| Ga0164309_114401242 | 3300012984 | Soil | FVHLSDTVRAPGVKQDALRRRGLAGIDVRHDADVPATL* |
| Ga0163162_103227104 | 3300013306 | Switchgrass Rhizosphere | ADAVRPARIKQDALSRSGLPGVDVRHDADVSAPL* |
| Ga0163162_125639501 | 3300013306 | Switchgrass Rhizosphere | MDLSDAMQSSRIEKNALGRSGLTSIDVGHDADVSATL* |
| Ga0181538_105259591 | 3300014162 | Bog | HLADTVRLSRIKQDALRRRGLPGIDVGHDADVPATF* |
| Ga0181532_105928021 | 3300014164 | Bog | RAFVHLADTVRLSRIKQDALRRRGLPGIDVGHDADVPATF* |
| Ga0181526_102212061 | 3300014200 | Bog | HLSDAVRLSRIKQDALRRSGLPGIDVGHDADIPAAL* |
| Ga0181537_101281421 | 3300014201 | Bog | SAFVHLSDAVRLSRIKQDALRRSGLSGINVRHDADIPAAF* |
| Ga0181537_108379251 | 3300014201 | Bog | LSDAVRLSRIKQDALRRSGLTGIDVGHDADVPAAF* |
| Ga0182018_101426663 | 3300014489 | Palsa | HLSDAMRLSRIEQDALRRSGLPGIDVGHDADVPATF* |
| Ga0182024_125010962 | 3300014501 | Permafrost | HLSDAVRLSRIEQDALRRSGLAGIDVGHDADVPATF* |
| Ga0181522_101716111 | 3300014657 | Bog | LANTVRASCIEQDALRGGGLTGIDVGHDADIPATL* |
| Ga0181519_101464063 | 3300014658 | Bog | AFVHLSDAVRLSRIKQDALRRSGLPGIDVGHDADIPAAL* |
| Ga0137420_14048521 | 3300015054 | Vadose Zone Soil | CSIQSMVAVPSWTSPMRCGLSRIKQDALGRSGLAGIDVGHDADVSAPF* |
| Ga0167668_10150123 | 3300015193 | Glacier Forefield Soil | ADTVRLSRIKQDALRRRGLPGIDVGHDADVPATF* |
| Ga0167668_10186213 | 3300015193 | Glacier Forefield Soil | ADTVRLSRIKQDALRRRGLPGIDVGHDADVPATL* |
| Ga0132256_1014715861 | 3300015372 | Arabidopsis Rhizosphere | LMNLTNAVRASCIEQDALRRGGLSGIDVGHDADVSATI* |
| Ga0132255_1000743467 | 3300015374 | Arabidopsis Rhizosphere | PDAVRTARIEEYALGRSSLAGIDVGHDADVSATL* |
| Ga0187817_101099031 | 3300017955 | Freshwater Sediment | LSDAVRPSCIKQDPLRRSGLAGIDVGHDADVSAAL |
| Ga0187857_101060051 | 3300018026 | Peatland | RAFVHLSDAVRLSRIKQDALRRSGLSGIDVGHDADVSAAF |
| Ga0066669_109417062 | 3300018482 | Grasslands Soil | VHLSDAVRPARIKQDALRRSGLSGIDVGHDADVSATL |
| Ga0182025_12186592 | 3300019786 | Permafrost | MVAVALVDLADTVRLSRIKQDALRRRGLPGIDVGHDTDVPATF |
| Ga0182025_12759421 | 3300019786 | Permafrost | MVAVPSCTSDAVRLSRIEQDALRRSGLAGIDVGHDADVPAAF |
| Ga0210388_107333483 | 3300021181 | Soil | RSAFVHLSDAVRLSRIKQDALRRSGLTGINVGHDADVSATL |
| Ga0242653_10039543 | 3300022712 | Soil | LSDAVRSARIKQDALRRSGFPGIDVGHDADVSATL |
| Ga0242661_10011431 | 3300022717 | Soil | VHLSDAVRSARIKQDALRRSGFPGIDVGHDADVSATL |
| Ga0207641_126359542 | 3300026088 | Switchgrass Rhizosphere | ARVEEDALGSRSLTGIDVSHDADIPATLQWNLSSH |
| Ga0209761_13267201 | 3300026313 | Grasslands Soil | HSCSAFMDLSDAVRPPGIEKDAFRRSGLTSIDVGHDADIPATV |
| Ga0209325_10241321 | 3300027050 | Forest Soil | LMNLSDAVRLSRIEKDALRRSGLAGIDVGHDADVPALF |
| Ga0209698_100030251 | 3300027911 | Watersheds | HLSDAVRPSRIKQDALRRSGLAGIDVGHDADVSAAL |
| Ga0311342_110792192 | 3300029955 | Bog | MHFANAVQAAGIEQDALGRCRLPGIDVRHDTDVPATF |
| Ga0311351_102581311 | 3300031722 | Fen | FVDLANAVRASRIEQDALRGRGLTGIDVRHDADISATL |
| Ga0306926_101290881 | 3300031954 | Soil | LSDPVRPSRIKQDALRRSGLTGIDVRHDADVSATL |
| Ga0334854_071307_2_121 | 3300033829 | Soil | AFVHLADTVRLSRIKQDALRRRGLPGIDVGHDADVPATF |
| Ga0334790_052504_26_139 | 3300033887 | Soil | VDLSDAVRLSGIEKDALRRSGLTGIDVGHNADVPAPF |
| Ga0370483_0023911_24_137 | 3300034124 | Untreated Peat Soil | VHLSDAVRLACVEQDALRRSGLTGIDVGHDADVPAAF |
| Ga0370484_0200955_421_534 | 3300034125 | Untreated Peat Soil | VDLANAVRASRIKQDALRGRGLTGIDVRHDADIPATF |
| Ga0370514_074910_31_144 | 3300034199 | Untreated Peat Soil | MHFANTVQAPGIKQNALGRCRLPGIDVRHDADVPATF |
| Ga0370548_004967_5_118 | 3300034644 | Soil | VDLSDAVRLSRIEQDALSRSGLTGINVSHDADVSAPF |
| ⦗Top⦘ |