| Basic Information | |
|---|---|
| Family ID | F088141 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTEERARHYAKALARNMGITFYVVRSREGRFLAVQIPSDS |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.50 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 93.58 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.046 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (52.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.725 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (57.798 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 14.71% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00873 | ACR_tran | 2.75 |
| PF07690 | MFS_1 | 1.83 |
| PF12796 | Ank_2 | 0.92 |
| PF00239 | Resolvase | 0.92 |
| PF07508 | Recombinase | 0.92 |
| PF00496 | SBP_bac_5 | 0.92 |
| PF13701 | DDE_Tnp_1_4 | 0.92 |
| PF02371 | Transposase_20 | 0.92 |
| PF00083 | Sugar_tr | 0.92 |
| PF07642 | BBP2 | 0.92 |
| PF02586 | SRAP | 0.92 |
| PF13358 | DDE_3 | 0.92 |
| PF00589 | Phage_integrase | 0.92 |
| PF02515 | CoA_transf_3 | 0.92 |
| PF12840 | HTH_20 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.83 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.92 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.92 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.92 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.05 % |
| All Organisms | root | All Organisms | 44.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_101742909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300004092|Ga0062389_101254290 | Not Available | 927 | Open in IMG/M |
| 3300004152|Ga0062386_100077657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2532 | Open in IMG/M |
| 3300005447|Ga0066689_10238592 | Not Available | 1115 | Open in IMG/M |
| 3300009137|Ga0066709_102601723 | Not Available | 678 | Open in IMG/M |
| 3300009792|Ga0126374_11243694 | Not Available | 598 | Open in IMG/M |
| 3300010046|Ga0126384_12191666 | Not Available | 532 | Open in IMG/M |
| 3300010048|Ga0126373_12407504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300010361|Ga0126378_10981282 | Not Available | 949 | Open in IMG/M |
| 3300010371|Ga0134125_12380330 | Not Available | 576 | Open in IMG/M |
| 3300010376|Ga0126381_100044641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5390 | Open in IMG/M |
| 3300010376|Ga0126381_100274765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2296 | Open in IMG/M |
| 3300010376|Ga0126381_104978046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300012202|Ga0137363_10895497 | Not Available | 753 | Open in IMG/M |
| 3300012205|Ga0137362_11352475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300012927|Ga0137416_10038906 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
| 3300016294|Ga0182041_10114794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2009 | Open in IMG/M |
| 3300016294|Ga0182041_11630005 | Not Available | 596 | Open in IMG/M |
| 3300016294|Ga0182041_12285622 | Not Available | 506 | Open in IMG/M |
| 3300016319|Ga0182033_10793698 | Not Available | 834 | Open in IMG/M |
| 3300016319|Ga0182033_11805938 | Not Available | 555 | Open in IMG/M |
| 3300016319|Ga0182033_11909409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300016357|Ga0182032_10712767 | Not Available | 843 | Open in IMG/M |
| 3300016357|Ga0182032_11852809 | Not Available | 528 | Open in IMG/M |
| 3300016387|Ga0182040_10221765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1404 | Open in IMG/M |
| 3300016387|Ga0182040_10471753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300016387|Ga0182040_11248301 | Not Available | 626 | Open in IMG/M |
| 3300016387|Ga0182040_11567474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300016422|Ga0182039_10260026 | Not Available | 1419 | Open in IMG/M |
| 3300016445|Ga0182038_11005183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300020581|Ga0210399_11091102 | Not Available | 639 | Open in IMG/M |
| 3300021178|Ga0210408_10626162 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300021178|Ga0210408_11342755 | Not Available | 541 | Open in IMG/M |
| 3300021560|Ga0126371_12556503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300021560|Ga0126371_12584555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300025915|Ga0207693_10910463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300027651|Ga0209217_1169660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300027874|Ga0209465_10572932 | Not Available | 561 | Open in IMG/M |
| 3300031057|Ga0170834_106063694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300031231|Ga0170824_128105418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
| 3300031474|Ga0170818_106673143 | Not Available | 777 | Open in IMG/M |
| 3300031474|Ga0170818_114794678 | Not Available | 934 | Open in IMG/M |
| 3300031474|Ga0170818_115384447 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300031543|Ga0318516_10528894 | Not Available | 676 | Open in IMG/M |
| 3300031544|Ga0318534_10666974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300031546|Ga0318538_10474502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300031573|Ga0310915_11271340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300031668|Ga0318542_10747385 | Not Available | 512 | Open in IMG/M |
| 3300031679|Ga0318561_10338724 | Not Available | 824 | Open in IMG/M |
| 3300031680|Ga0318574_10554492 | Not Available | 673 | Open in IMG/M |
| 3300031680|Ga0318574_10579314 | Not Available | 658 | Open in IMG/M |
| 3300031680|Ga0318574_10580090 | Not Available | 657 | Open in IMG/M |
| 3300031681|Ga0318572_10357689 | Not Available | 866 | Open in IMG/M |
| 3300031682|Ga0318560_10126020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1343 | Open in IMG/M |
| 3300031719|Ga0306917_10393233 | Not Available | 1081 | Open in IMG/M |
| 3300031719|Ga0306917_10688435 | Not Available | 803 | Open in IMG/M |
| 3300031736|Ga0318501_10741392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300031744|Ga0306918_11063739 | Not Available | 627 | Open in IMG/M |
| 3300031748|Ga0318492_10454610 | Not Available | 677 | Open in IMG/M |
| 3300031748|Ga0318492_10534359 | Not Available | 623 | Open in IMG/M |
| 3300031753|Ga0307477_10889582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300031754|Ga0307475_11337902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300031765|Ga0318554_10530371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300031769|Ga0318526_10394950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031781|Ga0318547_10875219 | Not Available | 560 | Open in IMG/M |
| 3300031793|Ga0318548_10165317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300031793|Ga0318548_10629536 | Not Available | 521 | Open in IMG/M |
| 3300031797|Ga0318550_10416305 | Not Available | 650 | Open in IMG/M |
| 3300031798|Ga0318523_10183469 | Not Available | 1044 | Open in IMG/M |
| 3300031798|Ga0318523_10353525 | Not Available | 732 | Open in IMG/M |
| 3300031798|Ga0318523_10462101 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031805|Ga0318497_10759858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300031819|Ga0318568_10570559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300031833|Ga0310917_10646269 | Not Available | 717 | Open in IMG/M |
| 3300031845|Ga0318511_10520564 | Not Available | 551 | Open in IMG/M |
| 3300031879|Ga0306919_10179056 | Not Available | 1564 | Open in IMG/M |
| 3300031880|Ga0318544_10370713 | Not Available | 556 | Open in IMG/M |
| 3300031893|Ga0318536_10424383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300031893|Ga0318536_10671199 | Not Available | 517 | Open in IMG/M |
| 3300031896|Ga0318551_10175934 | Not Available | 1177 | Open in IMG/M |
| 3300031897|Ga0318520_10393319 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031941|Ga0310912_10394644 | Not Available | 1077 | Open in IMG/M |
| 3300031942|Ga0310916_11042295 | Not Available | 681 | Open in IMG/M |
| 3300031946|Ga0310910_10570628 | Not Available | 897 | Open in IMG/M |
| 3300031947|Ga0310909_10075135 | Not Available | 2665 | Open in IMG/M |
| 3300031947|Ga0310909_10815102 | Not Available | 770 | Open in IMG/M |
| 3300031947|Ga0310909_11412028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300031962|Ga0307479_10058465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3715 | Open in IMG/M |
| 3300032001|Ga0306922_10600254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
| 3300032001|Ga0306922_10631402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300032025|Ga0318507_10384637 | Not Available | 611 | Open in IMG/M |
| 3300032039|Ga0318559_10292434 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300032052|Ga0318506_10497776 | Not Available | 540 | Open in IMG/M |
| 3300032055|Ga0318575_10329123 | Not Available | 774 | Open in IMG/M |
| 3300032059|Ga0318533_10358129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300032059|Ga0318533_10500382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300032059|Ga0318533_10571791 | Not Available | 829 | Open in IMG/M |
| 3300032060|Ga0318505_10196285 | Not Available | 944 | Open in IMG/M |
| 3300032064|Ga0318510_10109906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300032064|Ga0318510_10329008 | Not Available | 641 | Open in IMG/M |
| 3300032066|Ga0318514_10442607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300032068|Ga0318553_10686805 | Not Available | 535 | Open in IMG/M |
| 3300032076|Ga0306924_11019576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
| 3300032076|Ga0306924_11240132 | Not Available | 804 | Open in IMG/M |
| 3300032089|Ga0318525_10677948 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032090|Ga0318518_10156886 | Not Available | 1157 | Open in IMG/M |
| 3300032090|Ga0318518_10448657 | Not Available | 661 | Open in IMG/M |
| 3300032180|Ga0307471_103589729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300033290|Ga0318519_10117149 | Not Available | 1454 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 52.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1017429091 | 3300004091 | Bog Forest Soil | MTEERARANAKVLALGMGITFYVVRSREGRFLPVQLPSDDCE |
| Ga0062389_1012542902 | 3300004092 | Bog Forest Soil | MTKERAGDYAKKLALNMGITFYVVRSREGRFFAVQAPSDDCEIL |
| Ga0062386_1000776571 | 3300004152 | Bog Forest Soil | MTEERARHYARALARGMGITFYVVRSREGRFLAVQIPSDD |
| Ga0066689_102385924 | 3300005447 | Soil | MSEEAAYRTAEALALGMRITFYVVRSSQGRFLAVQIPSDDCQ |
| Ga0066709_1026017232 | 3300009137 | Grasslands Soil | MTEEQARRHAEALAFGMGITFYVVRSREGDFEPVQ |
| Ga0126374_112436942 | 3300009792 | Tropical Forest Soil | MTEEQALSTAQALAHSMGITFYVVRSREGLLLPVQSHRR |
| Ga0126384_121916661 | 3300010046 | Tropical Forest Soil | MTEEQARSRAEAVALAMGITFYVVRSREGGFASVQIP |
| Ga0126373_124075041 | 3300010048 | Tropical Forest Soil | MTEKRARHYAKALAQGMGITFYAVHTREGRFLAVQIPSDDCEILATATP |
| Ga0126378_109812821 | 3300010361 | Tropical Forest Soil | MERGASFMTKERARHYAKALARNMGITFYVVRSREGR |
| Ga0134125_123803301 | 3300010371 | Terrestrial Soil | MSEEQARFHAEALALGMGITFYVVRSRHGRYLPVQQPSDD |
| Ga0126381_10004464112 | 3300010376 | Tropical Forest Soil | MTEERARHYAKALARGMGITFYAVRSRTGRFLTVQI |
| Ga0126381_1002747654 | 3300010376 | Tropical Forest Soil | MTEKRARHYAKALARGMGITFHVVRSREGRFLAVQIPS |
| Ga0126381_1049780461 | 3300010376 | Tropical Forest Soil | MKRGAIFMTEERARHYAKALARSMGITFYVVRSREGRFLAVQIA |
| Ga0137363_108954971 | 3300012202 | Vadose Zone Soil | MTKEAARRVAKMLARGMGITFYVVRSRYGRFLAVQ |
| Ga0137362_113524753 | 3300012205 | Vadose Zone Soil | MTEEQARGYAEALASCMGITFYVVRSREGCFLPVQLPSDDC |
| Ga0137416_100389061 | 3300012927 | Vadose Zone Soil | MTEEAARRTAKVLARGMGITFYVVRSRYGRFLAVQIPSDDCKI |
| Ga0182041_101147943 | 3300016294 | Soil | MTEERARHFAKALARGMSLTFYVVRSPEGRFLAVQTPSDDCEILA |
| Ga0182041_116300051 | 3300016294 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPS |
| Ga0182041_122856222 | 3300016294 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSLGCEI |
| Ga0182033_107936981 | 3300016319 | Soil | MTEEQAHHYANALAQSMDITFYVVRSREGRFLPVQVPAADCEI |
| Ga0182033_118059381 | 3300016319 | Soil | MTEERAHHYAKALARGMGITFYAVRSREGRFLAVQIPSD |
| Ga0182033_119094091 | 3300016319 | Soil | MTQERACYYAEEIARNMGITFYVVRSREGRFMAVQIPSDDCEILAI |
| Ga0182032_107127671 | 3300016357 | Soil | MTEEKARHYANLLAQGMGIAFYVVRSREGRFLAVQIPSDDCEILARVA |
| Ga0182032_118528091 | 3300016357 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSDDCEIL |
| Ga0182040_102217652 | 3300016387 | Soil | MTEERARHYAKALARGMSLTFYVVRSPEGRFLAVQT |
| Ga0182040_104717533 | 3300016387 | Soil | MTQERACYYAEALARNMGITFHVVRTREGRFMAVQIPSDDC |
| Ga0182040_112483012 | 3300016387 | Soil | MTEESARYYAKALARSMGVSFYAVRSREGRFLGLQIPSDDCEILAKV |
| Ga0182040_115674741 | 3300016387 | Soil | MTEERARYYAKVLARGIGTTFYAVRSREGRFLAVQ |
| Ga0182039_102600263 | 3300016422 | Soil | MTEERARHYAEALAHSMGVIFYLVRSREGRFLAVQIPSHGCEVLATS |
| Ga0182038_110051831 | 3300016445 | Soil | MTEERARHYAKALARNMGITFYVVRSREGRFLAVQI |
| Ga0210399_110911022 | 3300020581 | Soil | MSEEAAHRTAKALALGMGITFYVVRSSQGRFLAVQQPPDDCEIL |
| Ga0210408_106261621 | 3300021178 | Soil | MTEERARHYAKALARNMGITFYVVRSREGRFLTVQIPS |
| Ga0210408_113427551 | 3300021178 | Soil | MTEDQARSQAEALAIGIGITFYVVRSAEGEFMPVQL |
| Ga0126371_125565032 | 3300021560 | Tropical Forest Soil | MTEEKARYYAQALAQSMGITFYVVRNREGRFLAVQIPSD |
| Ga0126371_125845553 | 3300021560 | Tropical Forest Soil | MTEERARHYAEALAQGMGITFYVVRSREGRFMAVQIPSD |
| Ga0207693_109104631 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEEQARSHAEALAIGMGITFYVVRSAEGEFMPVQLPPDDCEILAII |
| Ga0209217_11696601 | 3300027651 | Forest Soil | MTEERARHYAKALARNMGITFYVVRSREGRFLAVQIPSDDCEILAT |
| Ga0209465_105729321 | 3300027874 | Tropical Forest Soil | MTEERARHYAKALARNMDIPFYVVRSREGRFLAVQI |
| Ga0170834_1060636941 | 3300031057 | Forest Soil | MSEEIARHYAKALAQSMGITFYVVRSREGRFLPVQ |
| Ga0170824_1281054182 | 3300031231 | Forest Soil | MSEERARHYAETLAHSMGITFYVVRSCEGRFLPVQIPSVDCEVL |
| Ga0170818_1066731431 | 3300031474 | Forest Soil | MTEEKAHHYAKVLSRGMGVTFHAVRRRQGRFLAVQIPSDDCEI |
| Ga0170818_1147946781 | 3300031474 | Forest Soil | MTEEKAHHYAKVLSRGMGVTFHAVRSRQGRFLAVQIPSDDCEILAT |
| Ga0170818_1153844471 | 3300031474 | Forest Soil | MSEERARHYAETLAHSMGITFYVVRSREGRFLPVQIPSVDCEVL |
| Ga0318516_105288941 | 3300031543 | Soil | MTEERARYYAKALARNMGITFYVVRSREGRFLAVQ |
| Ga0318534_106669741 | 3300031544 | Soil | MTEERARYYAKALARNMGITFYVVRSREGRFLAVQIPSDDCEILATSGA |
| Ga0318538_104745021 | 3300031546 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSDDCEILATFTPP |
| Ga0310915_112713401 | 3300031573 | Soil | MTEERARHYAKSLARNMGITFYVVRSREGRFLAVQIPSND |
| Ga0318542_107473851 | 3300031668 | Soil | MTEERAQHYAKALAHSMGITFYLVRSREGRFLAVQIPSIGCEI |
| Ga0318561_103387241 | 3300031679 | Soil | VTEEKARHYARTLAEGMGITFYVVRSRDGRFLPVQL |
| Ga0318574_105544921 | 3300031680 | Soil | MTEERARHYAKALARGMGITFYVVRSRKGGFLAVQIPSDDCEIR |
| Ga0318574_105793142 | 3300031680 | Soil | MTEERAHHYAKALARGMGITFYAVRSREGRFLAVQIPSDDCE |
| Ga0318574_105800901 | 3300031680 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSLGC |
| Ga0318572_103576893 | 3300031681 | Soil | MTEERARHYAEALAHSMGVTFYLVRSREGRFLAVQIPSHGCEVLATSTPSN |
| Ga0318560_101260201 | 3300031682 | Soil | MTEERARYYAEALAQSMGITFYVVRNREGRFLAVQIPSD |
| Ga0306917_103932331 | 3300031719 | Soil | MTEDKARHYAEALPQSMGITFYVVRSHEGGFLPVQIPS |
| Ga0306917_106884352 | 3300031719 | Soil | MTEERARHYAEALAHSMGVTFYLVRSREGRFLAVQIPSHGC |
| Ga0318501_107413921 | 3300031736 | Soil | MTEERARHYAKSLARNMGITFYVVRSREGRFLAVQ |
| Ga0306918_110637391 | 3300031744 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSDDCE |
| Ga0318492_104546102 | 3300031748 | Soil | MTEESARYYAKALARSMGVSFYAVRSREGRFLGLQI |
| Ga0318492_105343592 | 3300031748 | Soil | MTEERARHYAETLAHSMGITFYVVRSREGRFLTVQT |
| Ga0307477_108895821 | 3300031753 | Hardwood Forest Soil | MTEERARYYAKALARSMGVTFHAVRSREGRFLAVQIPSDDCEV |
| Ga0307475_113379021 | 3300031754 | Hardwood Forest Soil | MTEERARHYAKALARGMGITFYVVRSRQGRFLAVQI |
| Ga0318554_105303712 | 3300031765 | Soil | MTEERARHYAKALARNMGITFYVVRSREGRFLAVQIPSDS |
| Ga0318526_103949501 | 3300031769 | Soil | MTEERARYYAKALARNMGITFYVVRSREGRFLAVQIPSDDCEI |
| Ga0318547_108752192 | 3300031781 | Soil | MTEERARHYAETLAHSIGITFYVVRSREGRFLTVQTPSDAAK |
| Ga0318548_101653172 | 3300031793 | Soil | MTEESARYYAKALARSMGVSFYAVRSREGRFLGLQIPSDDCEILAKVTP |
| Ga0318548_106295361 | 3300031793 | Soil | MTEERARHYAKALARRMGITFYVVRSREGRVPAVQ |
| Ga0318550_104163052 | 3300031797 | Soil | MTEERARYYAKALAQNMGITFYVVRSREGRFLAVQIPSDDCE |
| Ga0318523_101834694 | 3300031798 | Soil | MTEERARHYAKVLARGMGITFYAVRSRTGRFLTAQI |
| Ga0318523_103535252 | 3300031798 | Soil | VTEEKARHYARTLAEGMGITFYVVRSRDGRFLPVQLP |
| Ga0318523_104621012 | 3300031798 | Soil | MTEERARYYAKVLARSIGTTFYAVRSREGRFLAVQIPSG |
| Ga0318497_107598581 | 3300031805 | Soil | MTEESARYYAKALARSMGVSFYAVRSREGRFLGLQIPSDDCEILAKVTPPGSLHD |
| Ga0318568_105705592 | 3300031819 | Soil | MTEERARYYAKALARNMGITFYVVRSREGRFLAVQIPSDSCEILATLAP |
| Ga0310917_106462691 | 3300031833 | Soil | MTEGKARHYAQALAEGVGITFYVVRSPEGGFLAVQIPSVDCE |
| Ga0318511_105205641 | 3300031845 | Soil | MTEERARHYAKALARGMGITFYVVRSRKGGFLAVQI |
| Ga0306919_101790565 | 3300031879 | Soil | MTEERARHYAEALAHSMGVTFYLVRSREGRFLAVQIPSHGCEV |
| Ga0318544_103707131 | 3300031880 | Soil | MTEERACHYAKVLARGMGVTFYVVRSRAGRFLAVQIPSD |
| Ga0318536_104243832 | 3300031893 | Soil | MTEERARHYAETLAHSMGITFYVVRSREGRFPTVQTPSDDC |
| Ga0318536_106711991 | 3300031893 | Soil | MTEERARYYAKALAQNMGITFYVVRSREGRFLAVQIPSDD |
| Ga0318551_101759341 | 3300031896 | Soil | MTEERARHYAETLAHSIGITFYVVRSREGRFLTVQTPSDAA |
| Ga0318520_103933192 | 3300031897 | Soil | MTKERARHYAKALAQGMGITFYVVRSREGRFLAVQIPSDDCEILA |
| Ga0310912_103946442 | 3300031941 | Soil | MTEEQAHHYANALAQSMDITFYVVRSREGRFLPVQVPSAD |
| Ga0310916_110422952 | 3300031942 | Soil | MTEDRARHYARVLARGMDVTFYVVHSREGCFLAVQ |
| Ga0310910_105706282 | 3300031946 | Soil | MTEEKARHYAKVLAQSLGITFYVVSTREGHFLAVQIPSEDCEIIAKIS |
| Ga0310909_100751357 | 3300031947 | Soil | MTEERARHYAEALAHSMGVTFYLVRSREGRFLAVQIPSHGCEVLAM |
| Ga0310909_108151021 | 3300031947 | Soil | MTEDKACHYAEALAQSMGITFYVVWSHEGGFLPVQI |
| Ga0310909_114120281 | 3300031947 | Soil | MTEDRARHYAEALAHSMGITFYMVRSREGRFLTVQIPSDDCEVLA |
| Ga0307479_100584651 | 3300031962 | Hardwood Forest Soil | MTEERARHYAKALARGMGITFYVVRSRQGRFLAVQIPSDD |
| Ga0306922_106002543 | 3300032001 | Soil | MTEERARHYAKSLARNMGITFYVVRSREGRFLAVQIP |
| Ga0306922_106314022 | 3300032001 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSD |
| Ga0318507_103846371 | 3300032025 | Soil | MTEESARYYAKALARSMGVSFYAVRSREGRFLGLQIPSDDCEILAKVT |
| Ga0318559_102924341 | 3300032039 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSDDC |
| Ga0318506_104977761 | 3300032052 | Soil | MTEERARHYAKALARGMSLTFYVVRSPEGRFLAVQTPSDDCE |
| Ga0318575_103291231 | 3300032055 | Soil | MTEERARHYAKVLARGMGITFYAVRSRTGRFLTVQIPSDDCEI |
| Ga0318533_103581291 | 3300032059 | Soil | MTEERACHYAKALAHNMDTTFYAVRSRGGRFLAVQIPSDDCEILATFT |
| Ga0318533_105003822 | 3300032059 | Soil | MAKEKARYYAQVLAQNMGITFYVVRNREGRFLAVQMPSDGYE |
| Ga0318533_105717912 | 3300032059 | Soil | MTEERARHYAEVLAQSTGITFYVVRNSEGRFLAVQI |
| Ga0318505_101962853 | 3300032060 | Soil | MTEERACYYAKALAHSMGITFYLVRSREGRFLAVQI |
| Ga0318510_101099061 | 3300032064 | Soil | MTEESARYYAKALARSMGVTFYAVRSREGRFLAVQIPSDDCQILAKVT |
| Ga0318510_103290081 | 3300032064 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQIPSLGCEILA |
| Ga0318514_104426071 | 3300032066 | Soil | MTEERARHYAKALARGMGITFYVVRSRKGGFLAVQIPSDDCEIRATVA |
| Ga0318553_106868051 | 3300032068 | Soil | MTEERARYYAKALARSMGVTFYAVRSREGRFLAVQ |
| Ga0306924_110195761 | 3300032076 | Soil | MTEERACHYAKALAHNMGTTFYAVRSREGRFLAVQIPSDDCEILTTVMP |
| Ga0306924_112401322 | 3300032076 | Soil | MTEERARHYAKTLARNMGITFYVVRSREGRFLAVQIP |
| Ga0318525_106779481 | 3300032089 | Soil | MTEERARYYAKVLARSIGTTFYAVRSREGRFLAVQIPS |
| Ga0318518_101568865 | 3300032090 | Soil | MTEERARHYAKALARGMGITFYAVRSRTGRFLTVQ |
| Ga0318518_104486571 | 3300032090 | Soil | MTEERARHYAKALARNMDITFYVVRSGEGRFLAVQI |
| Ga0307471_1035897291 | 3300032180 | Hardwood Forest Soil | MTEERARYYATALAHSMGITFYVIRTREGRFLTVQTPSDDCEVLVLRSPCIAKSL |
| Ga0318519_101171491 | 3300033290 | Soil | MTEEKARHYAKVLAQSLGITFYVVSTREGHFLAVQI |
| ⦗Top⦘ |