| Basic Information | |
|---|---|
| Family ID | F088048 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEPNYTAVR |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.96 % |
| % of genes near scaffold ends (potentially truncated) | 46.79 % |
| % of genes from short scaffolds (< 2000 bps) | 88.07 % |
| Associated GOLD sequencing projects | 53 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.817 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (34.862 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (74.312 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF14110 | DUF4282 | 4.59 |
| PF02560 | Cyanate_lyase | 0.92 |
| PF00589 | Phage_integrase | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF02353 | CMAS | 0.92 |
| PF04226 | Transgly_assoc | 0.92 |
| PF07690 | MFS_1 | 0.92 |
| PF07045 | DUF1330 | 0.92 |
| PF01391 | Collagen | 0.92 |
| PF06577 | EipA | 0.92 |
| PF13410 | GST_C_2 | 0.92 |
| PF11154 | DUF2934 | 0.92 |
| PF01068 | DNA_ligase_A_M | 0.92 |
| PF13202 | EF-hand_5 | 0.92 |
| PF17201 | Cache_3-Cache_2 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.92 |
| COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.92 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.92 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.92 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.92 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.92 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.92 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.82 % |
| All Organisms | root | All Organisms | 20.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 34.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100138576 | 3300000793 | Forest Soil | MRYIAYGLAIIAAGFVLAFMATDLPRDATASHNEPNYTAVR* |
| Ga0066395_101521721 | 3300004633 | Tropical Forest Soil | MRYIAYGLAIIAAGFVLAFMATDLPRDTTASHNEPNYTAVR* |
| Ga0066395_108379891 | 3300004633 | Tropical Forest Soil | MRYIAYGLAILAAVCAIAFTTGNLPRGATASHNDSNYTAVR* |
| Ga0066395_109709751 | 3300004633 | Tropical Forest Soil | MRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANYTAVR* |
| Ga0066388_1002953942 | 3300005332 | Tropical Forest Soil | MRYIAYGLAVFAAGFVLAFTTGYLSRHGTASHFNEFNYTTVR* |
| Ga0066388_1004542883 | 3300005332 | Tropical Forest Soil | MRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR* |
| Ga0066388_1016069341 | 3300005332 | Tropical Forest Soil | FKPLGPHGAYPMRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANYTAVR* |
| Ga0066388_1016835333 | 3300005332 | Tropical Forest Soil | MRYIAYGLAILAAVLAILFVTGNLSRNATATSHHESNYTAVH* |
| Ga0066388_1019890751 | 3300005332 | Tropical Forest Soil | MIISTLGPTHGGYPMRYIAYGLAIAYGLAIVVATVFTVAFATGYLPRDATIASHNEPNYTAVR* |
| Ga0066388_1021133661 | 3300005332 | Tropical Forest Soil | MRYIAYGLALLAAVCAIAFTTGNLPRDATASHNDYTAVR* |
| Ga0066388_1023048601 | 3300005332 | Tropical Forest Soil | YIAYGLAIFAAVFVIAFTTGYLPRDAAASHNEPNYTAVR* |
| Ga0066388_1028028761 | 3300005332 | Tropical Forest Soil | MRYIAYGLAIFAAGFVLAFTTGYLSRHGTASHFNEFNYTAVR* |
| Ga0066388_1029640722 | 3300005332 | Tropical Forest Soil | MRYIAYALAIFAAVFVLAFTIGFLPRDATASHNESYYTAVR* |
| Ga0066388_1032920631 | 3300005332 | Tropical Forest Soil | LMRYLASGLAILAAVCAIAFTTGNLPRGATASHNDSNYTAVR* |
| Ga0066388_1038216731 | 3300005332 | Tropical Forest Soil | FKPLGPHGAYPMRYIAYGLAIFAAVFVIAFTTGYLPRDATASHHEANKTAVR* |
| Ga0066388_1041277081 | 3300005332 | Tropical Forest Soil | MRYIAYGLAIFAALLAIIFVTGNLSRDATASHNYSNYTAVR* |
| Ga0066388_1044677812 | 3300005332 | Tropical Forest Soil | MRYIAYGLAILAAVFVLAFMATYLPRDATASHNEPNYTAVR* |
| Ga0066388_1073682541 | 3300005332 | Tropical Forest Soil | MRYIAYGLAILAAVSVLAFTTGYLPRDATALHFNEPNYTAVR* |
| Ga0066388_1086980711 | 3300005332 | Tropical Forest Soil | MRYIAYGLAILAAVCAIAFTAGNLPRDATASHNDYTAVR* |
| Ga0066903_1013460491 | 3300005764 | Tropical Forest Soil | KPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR* |
| Ga0066903_1017858695 | 3300005764 | Tropical Forest Soil | MRYIAYGLAIIAAGFVLAFMATDLPRDATASHNEPNYTA |
| Ga0066903_1017950452 | 3300005764 | Tropical Forest Soil | MRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEPNYTAVR* |
| Ga0066903_1018884493 | 3300005764 | Tropical Forest Soil | MRYIAYGLAILAAVLTIAFITGNPPRDANASHNDPNYTAVR* |
| Ga0066903_1021326361 | 3300005764 | Tropical Forest Soil | MHGAYPMRYIAYGLGIFAAVFVIAFTTGYLPRDATASHNEPNYTAVR* |
| Ga0066903_1025610682 | 3300005764 | Tropical Forest Soil | MRYIAYGLAIFAAVFIIAFTTGYLPRDATASHNEPNYTAVR* |
| Ga0066903_1028419432 | 3300005764 | Tropical Forest Soil | MRYIAYGLAIFAAGFVLAFTTGYLSRHGTASHFNEFNYTAVRLV* |
| Ga0066903_1028908252 | 3300005764 | Tropical Forest Soil | MRYIAYGLAILAAVCAIAFTTGNLPRGATASHNNYTAVR* |
| Ga0066903_1034587122 | 3300005764 | Tropical Forest Soil | MRYITYGLAIFAAAFVLAFMAGYLPRDATASHNEPNYTAVR* |
| Ga0066903_1041614862 | 3300005764 | Tropical Forest Soil | MRYIAYGLAVFAAGFVLAFTTGYLSRHGTASHFNEFNYTAVR* |
| Ga0066903_1044784213 | 3300005764 | Tropical Forest Soil | RETSGANASSKPMRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEPNYTAVR* |
| Ga0066903_1047923411 | 3300005764 | Tropical Forest Soil | MRYIAYGLAILAAVCAIAFTAGNLPRDATASHNNYTAVR* |
| Ga0066903_1062842752 | 3300005764 | Tropical Forest Soil | MRYLAYGLAILAAVCTIAFTTGNLPRGATASHNDSNYTAIR* |
| Ga0066903_1067727262 | 3300005764 | Tropical Forest Soil | RKLMRYIAYGLAILAAVCAIAFTTGNLPRDATASHNNYTAVR* |
| Ga0066903_1077962652 | 3300005764 | Tropical Forest Soil | MRYLACGLAILAAVCAIAFTTGNLPRGATASHIDSNYTAVR* |
| Ga0066903_1079512541 | 3300005764 | Tropical Forest Soil | NPMRYIAYGLAILAAVCAIAFTTGNLPRDATASHNDSNYTAVR* |
| Ga0066903_1079718841 | 3300005764 | Tropical Forest Soil | MRYLAYGLAILAAVCAIAFTTDNLPRGATASHNDSNYTAVR* |
| Ga0066903_1087778171 | 3300005764 | Tropical Forest Soil | MRYLAYGLAILAAVCAVAFTTDNLPRGATASHNDSNYTAVR* |
| Ga0066652_1001265262 | 3300006046 | Soil | MRYIAYGLAILAAVSAVAFTTGYLPRDATASHHENNDTTNTK* |
| Ga0126380_121731221 | 3300010043 | Tropical Forest Soil | GLAILAAVCAVAFTTGNLPRGATASHNDSNYTAVR* |
| Ga0126384_105784933 | 3300010046 | Tropical Forest Soil | GANVLSKPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR* |
| Ga0126373_101583053 | 3300010048 | Tropical Forest Soil | MRYIAYGLAILAAVCAIAFTTGNLPRGATASHNDYTAVR* |
| Ga0131853_113667541 | 3300010162 | Termite Gut | VHYIAYGLAIFAAVLAIVFVTGNLSRDAAASHNDPNYTAIR* |
| Ga0126370_119488222 | 3300010358 | Tropical Forest Soil | AVMRYIAYGLAIIAAGFVLAFMATDLPRDATASHNEPNYTAVR* |
| Ga0126372_101423033 | 3300010360 | Tropical Forest Soil | MRYLAYGLAILAAVFVLAFTTGFLPRDATASHNEPNYTAVR* |
| Ga0126378_100839341 | 3300010361 | Tropical Forest Soil | ISGANASSKPMRYIAYGLAIFAAVFVIAFTTGYLPRDAAASHNEPNYTAVR* |
| Ga0126378_102323991 | 3300010361 | Tropical Forest Soil | MRYLAYGLAILAAVFVLAFTTGFLPRDATALHNEPNYTAVR* |
| Ga0126379_108490184 | 3300010366 | Tropical Forest Soil | MRYIAYGLAIFAAVLAIAFTTGNLPRDATASHNETNDTM |
| Ga0126379_116399791 | 3300010366 | Tropical Forest Soil | LCSPGPMYYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEPIYTAVR* |
| Ga0126381_1002707291 | 3300010376 | Tropical Forest Soil | MRYIAYGLAIFAAVLAILFVTGNLSRNATATSHHESNYTAVH* |
| Ga0126381_1015797891 | 3300010376 | Tropical Forest Soil | VHYIAYGLAIFAALLAIVFVTGNLHRDANASHNDPNYTAIR* |
| Ga0126381_1020700301 | 3300010376 | Tropical Forest Soil | ASSKPMRYIAYGLAIFAAVFVIAFTTGYLPRDAAASHNEPNYTAVR* |
| Ga0137381_104658711 | 3300012207 | Vadose Zone Soil | MRYIAYGLAIFAAVLTVAFTTGYLPRDATASHNETNDTMNVLQ |
| Ga0137376_114012691 | 3300012208 | Vadose Zone Soil | MRYIAYGLAIFAAVLTVAFTTGYLPRDATASHNET |
| Ga0137371_111780261 | 3300012356 | Vadose Zone Soil | MRYIAYGLAIFAVVLTVAFATGFLPRDATASHNDTNDTMNVLK |
| Ga0126369_110916881 | 3300012971 | Tropical Forest Soil | MRYIAYGLAIIAAGFVLAFMATDLPRDATASHNEPN |
| Ga0126369_123918901 | 3300012971 | Tropical Forest Soil | SGRWGKRALRKPMRYIAYGLAIFAAVFIIAFTTGYLPRDATASHNEPNYTAVR* |
| Ga0182036_113683991 | 3300016270 | Soil | MRYIVGLAIFAAMFTVAFATSYLPLDATPSHNETNDT |
| Ga0182041_121728721 | 3300016294 | Soil | MRYIAYGLAILAAVFVLAFMATYLPRDATASHNEPNYTAVR |
| Ga0182033_115884951 | 3300016319 | Soil | MRYIAYGLAIFAAVLTVAFTANYLPRDATASHNETNDTMN |
| Ga0182032_114541752 | 3300016357 | Soil | AANGFAFAYGLAIIAAGFVLAFMATDLPRDATASHNEPNYTAVR |
| Ga0182034_108656081 | 3300016371 | Soil | MRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEP |
| Ga0182037_108785171 | 3300016404 | Soil | ANVLSKPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR |
| Ga0182038_109091991 | 3300016445 | Soil | SKPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR |
| Ga0187818_105696611 | 3300017823 | Freshwater Sediment | MRYIVGATILAAVVAVAIGTGRLPRIATASHNDAND |
| Ga0187783_1000177129 | 3300017970 | Tropical Peatland | MHYIAYGLAVFAAVLAIVFVTGNLPRDAAASHNDPNYTAIR |
| Ga0187783_102045332 | 3300017970 | Tropical Peatland | MHYIAYGFAIFAAVLAIVFVTGNVPRDATASHNDPNYTAIR |
| Ga0187783_102284603 | 3300017970 | Tropical Peatland | MHYIGYGLAIFAAVLAIVFVTGNLPRDANASHSDPNYTAIR |
| Ga0187783_105569813 | 3300017970 | Tropical Peatland | MHYIAYGLAIFAAVLAIVFVTGNLPRDATASLNDPNYTAIR |
| Ga0187783_106765521 | 3300017970 | Tropical Peatland | MQYIISGLAIFAAVLAIVFVTGNLPPDATASHSGPNYTAIR |
| Ga0187765_101639001 | 3300018060 | Tropical Peatland | MHHIAYGLAILAAVLAIVFVTGKLPRDATASHNDPNYTAIR |
| Ga0066655_106462951 | 3300018431 | Grasslands Soil | MRYLAYGLAILAAVSAVAFTTGYLPRDATASHHENND |
| Ga0126371_103933611 | 3300021560 | Tropical Forest Soil | MRYLASGLAILAAVCAIAFTTGNLPRGATASHNDSNYTAVR |
| Ga0126371_107877512 | 3300021560 | Tropical Forest Soil | MRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANYTAVR |
| Ga0126371_113635431 | 3300021560 | Tropical Forest Soil | MRYIAYGLAIIAAGFVLAFMATDLPRDATASHNEPNYTAVR |
| Ga0126371_136721042 | 3300021560 | Tropical Forest Soil | MRYIAYGLAILAAVSVLAFTTGYLPRDATALHFNEPNYTAVR |
| Ga0207758_10112761 | 3300026895 | Tropical Forest Soil | MLHRLRLAIFAAVLTVAFTAGYLPRDATASHNETNG |
| Ga0207783_10210583 | 3300026942 | Tropical Forest Soil | MRYIAYGLAIFAAVLAIALTTSNLPRDATASHNETND |
| Ga0318541_100950831 | 3300031545 | Soil | MRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANY |
| Ga0318528_105198981 | 3300031561 | Soil | GPHGAYPMRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANYTAVR |
| Ga0318573_106655381 | 3300031564 | Soil | IQPLGPHGAYPMRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANYTAVR |
| Ga0318542_106819351 | 3300031668 | Soil | MRYIAYGLAIFAAVLAIAFTSGNLPRDATASHDETNDTMN |
| Ga0318500_100200461 | 3300031724 | Soil | MRYIAYGLAIITAGFVLAFMATDLPRDATASHNEPNYTAVR |
| Ga0306918_100856286 | 3300031744 | Soil | MRYIAYGLAILAAVCAIAFTAGNLPRDATASHNNYTAVR |
| Ga0306918_102137973 | 3300031744 | Soil | MRYIAYGLAIFAAVLTVAFTAGYLPRDATASHNETNDAINVLQ |
| Ga0318502_109202173 | 3300031747 | Soil | NILSKPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR |
| Ga0318537_100813831 | 3300031763 | Soil | MRYIAYGLAIFAAVLTVAFTAGYLPRDATASHNETNDAINVLQLE |
| Ga0318546_106356631 | 3300031771 | Soil | FRTSGANAFRKLMRYIAYGLAILAAVCAIAFTAGNLPRDATASHNNYTAVR |
| Ga0318547_101926913 | 3300031781 | Soil | SGANAFRKLMRYIAYGLAILAAVCAIAFTAGNLPRDATASHNNYTAVR |
| Ga0318552_106041743 | 3300031782 | Soil | ITIVIQAPGANVLSKPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR |
| Ga0318529_104412672 | 3300031792 | Soil | MRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEAN |
| Ga0318576_101024842 | 3300031796 | Soil | MRYLAYGLAILAAVCTIAFTTGNLPRGATASHNDSNYTAIR |
| Ga0310917_105163963 | 3300031833 | Soil | MRYIAYGLAIFAAVLAIAFTSGNLPRDATASHDETNDTMNVLQLE |
| Ga0318517_104981852 | 3300031835 | Soil | MRYIAYGLAIFAAVLAIAFTTGNLPRDATASHNDTN |
| Ga0310916_100529293 | 3300031942 | Soil | MRYIAYGLAIIAAGFALAFIATDLPRDATASHNEPNYTAVR |
| Ga0310916_112443361 | 3300031942 | Soil | MRYIAYGLAILAAVFVLAFTTGFLPLDATASHNEPNYTAVR |
| Ga0306926_121317261 | 3300031954 | Soil | MRYIAYGLAILAAGFVLAFMATYLPRDATASHNEPNYTAVR |
| Ga0306926_122574751 | 3300031954 | Soil | MHGENPMRYIAYGLAIFAAVFALAFTTGYLPRDATASHNEPYYTAVR |
| Ga0318530_105005332 | 3300031959 | Soil | FLITIVIQAPGANILSKPMRYIAYGLAILAAASVLAFTTGYLPRDATASHNNEPYYTAVR |
| Ga0318549_100283861 | 3300032041 | Soil | MRYIAYGLAIIAAVFVLAFMATDLPRDATASHNEPNYTAVR |
| Ga0318549_101210053 | 3300032041 | Soil | AYGLAIITAGFVLAFMATDLPRDATASHNEPNYTAVR |
| Ga0318532_101194853 | 3300032051 | Soil | MRYIAYGLAIFAAVLTVAFTAGYLPRDATASHNETNDAI |
| Ga0318524_105148681 | 3300032067 | Soil | GVLLPMRYIAYGLAIFAAVFVIAFTTGYLPRDATASHNEANYTAVR |
| Ga0318540_101153172 | 3300032094 | Soil | MRYIAYGLAILAAVCTIAFTAGNLPRDATASHNNYTAVR |
| Ga0318540_104611052 | 3300032094 | Soil | MRYIAYGLAIFAAVLTVAFTAGYLPRDATASHNETNDAIN |
| Ga0306920_1003268203 | 3300032261 | Soil | MRYLAYGLAILAAVCAIAFTTGNLPRGATASHNDYTAVR |
| Ga0306920_1009841642 | 3300032261 | Soil | MRYIAYGLAIFAAVFALAFTTGYLPRDATASHNEPYYTAVR |
| Ga0306920_1017686962 | 3300032261 | Soil | MRYIAYGLAIFAALFAIAFTTGNLPRDATASHDGTSVDAAINATV |
| Ga0306920_1021056551 | 3300032261 | Soil | MHYIAYGLAIFAAVLAVVFVTGNLPRDATASHNDPNYTAIR |
| Ga0306920_1032559832 | 3300032261 | Soil | MRYIAYGLAILAAVLTVAFTTGYLPRDATASHNETNDTMN |
| ⦗Top⦘ |