Metagenome Family F088033

Overview

Basic Information

• Family ID: F088033
• Family Type: Metagenome
• Number of Sequences: 109
• Average Sequence Length: 38 residues
• Representative Sequence: VSFELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE
• Number of Associated Samples: 19
• Number of Associated Scaffolds: 109

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 90.83 %
• % of genes from short scaffolds (< 2000 bps): 87.16 %
• Associated GOLD sequencing projects: 17
• AlphaFold2 3D model prediction: No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (93.578 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms (89.908 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 13.16%
  Coil/Unstructured: 86.84%

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF05699	Dimer_Tnp_hAT	0.92
PF16184	Cadherin_3	0.92

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
All Organisms	root	All Organisms	6.42 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
cellular organisms	root	All Organisms → cellular organisms	6.42 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.50 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.92 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5.50 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.92 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.92 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.92 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.92 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.92 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.92 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.92 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.92 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.92 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	0.92 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.92 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.92 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	0.92 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	0.92 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.92 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Psylloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Psyllidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea → Psyllidae	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Psyllinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea → Psyllidae → Psyllinae	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Cacopsylla	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea → Psyllidae → Psyllinae → Cacopsylla	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.58 %
Cacopsylla melanoneura	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea → Psyllidae → Psyllinae → Cacopsylla → Cacopsylla melanoneura	0.92 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.92 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300003786|Ga0049116_10016012	Not Available	1240
3300003906|JGI26667J51740_10025140	Not Available	1147
3300004630|Ga0049105_1159135	Not Available	1419
3300004630|Ga0049105_1268049	Not Available	816
3300004632|Ga0049107_10167139	Not Available	1537
3300010290|Ga0126333_1033453	Not Available	2482
3300010290|Ga0126333_1076032	Not Available	1706
3300010290|Ga0126333_1087499	Not Available	1580
3300010290|Ga0126333_1154840	Not Available	1101
3300010290|Ga0126333_1167686	Not Available	1038
3300010290|Ga0126333_1182417	Not Available	973
3300010290|Ga0126333_1195572	Not Available	921
3300010290|Ga0126333_1274930	Not Available	682
3300010292|Ga0126326_1209860	Not Available	890
3300010292|Ga0126326_1219695	Not Available	859
3300010292|Ga0126326_1227553	Not Available	835
3300010292|Ga0126326_1237641	Not Available	806
3300010292|Ga0126326_1244277	Not Available	788
3300010292|Ga0126326_1292766	Not Available	675
3300010294|Ga0126332_10014803	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3927
3300010294|Ga0126332_10068717	Not Available	2047
3300010294|Ga0126332_10075936	Not Available	1937
3300010294|Ga0126332_10081083	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1868
3300010294|Ga0126332_10082876	Not Available	1845
3300010294|Ga0126332_10089101	Not Available	1771
3300010294|Ga0126332_10114569	Not Available	1518
3300010294|Ga0126332_10137501	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1340
3300010294|Ga0126332_10140541	Not Available	1320
3300010294|Ga0126332_10154443	Not Available	1232
3300010294|Ga0126332_10173654	Not Available	1127
3300010294|Ga0126332_10209721	Not Available	966
3300010294|Ga0126332_10230927	Not Available	889
3300010294|Ga0126332_10240138	Not Available	858
3300010294|Ga0126332_10370727	Not Available	568
3300010294|Ga0126332_10375635	Not Available	561
3300010295|Ga0126334_10036645	Not Available	2607
3300010295|Ga0126334_10052721	Not Available	2216
3300010295|Ga0126334_10065140	Not Available	2001
3300010295|Ga0126334_10142178	Not Available	1278
3300010295|Ga0126334_10217820	Not Available	930
3300010295|Ga0126334_10229080	Not Available	892
3300010295|Ga0126334_10265824	Not Available	785
3300010295|Ga0126334_10328585	Not Available	649
3300010295|Ga0126334_10403524	Not Available	539
3300010295|Ga0126334_10426167	Not Available	513
3300010298|Ga0126325_10144796	Not Available	1258
3300010298|Ga0126325_10159377	Not Available	1182
3300010298|Ga0126325_10165897	Not Available	1151
3300010298|Ga0126325_10182020	Not Available	1081
3300010298|Ga0126325_10185863	Not Available	1066
3300010298|Ga0126325_10220518	Not Available	943
3300010298|Ga0126325_10238257	Not Available	890
3300010298|Ga0126325_10272519	Not Available	801
3300010298|Ga0126325_10377473	Not Available	614
3300010314|Ga0126331_1031655	Not Available	2687
3300010314|Ga0126331_1059627	Not Available	2017
3300010314|Ga0126331_1111849	Not Available	1409
3300010314|Ga0126331_1123483	Not Available	1319
3300010314|Ga0126331_1180930	Not Available	995
3300010314|Ga0126331_1202603	Not Available	905
3300010314|Ga0126331_1234942	Not Available	793
3300010314|Ga0126331_1335453	All Organisms → cellular organisms → Eukaryota → Opisthokonta	558
3300010315|Ga0136654_1092213	Not Available	1603
3300010315|Ga0136654_1137533	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea → Psyllidae → Psyllinae → Cacopsylla → Cacopsylla melanoneura	1246
3300010315|Ga0136654_1141148	Not Available	1224
3300010315|Ga0136654_1151951	Not Available	1163
3300010315|Ga0136654_1167825	Not Available	1081
3300010315|Ga0136654_1187868	Not Available	991
3300010315|Ga0136654_1198524	Not Available	948
3300010315|Ga0136654_1202954	Not Available	931
3300010315|Ga0136654_1238327	Not Available	811
3300010315|Ga0136654_1258020	Not Available	753
3300010377|Ga0126328_10051691	Not Available	2212
3300010377|Ga0126328_10080744	Not Available	1770
3300010377|Ga0126328_10247488	Not Available	822
3300010377|Ga0126328_10276549	Not Available	745
3300010377|Ga0126328_10340506	Not Available	614
3300010378|Ga0126330_10006716	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4619
3300010378|Ga0126330_10034679	Not Available	2629
3300010378|Ga0126330_10090243	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1665
3300010378|Ga0126330_10105756	Not Available	1519
3300010378|Ga0126330_10110635	Not Available	1477
3300010378|Ga0126330_10137869	Not Available	1284
3300010378|Ga0126330_10148060	Not Available	1224
3300010378|Ga0126330_10237371	Not Available	854
3300010378|Ga0126330_10393534	Not Available	541
3300011190|Ga0126327_10065489	Not Available	1859
3300011190|Ga0126327_10147918	Not Available	1180
3300011190|Ga0126327_10218283	Not Available	893
3300011190|Ga0126327_10318884	Not Available	650
3300011190|Ga0126327_10363879	Not Available	577
3300012273|Ga0126329_10042590	Not Available	2349
3300012273|Ga0126329_10088306	Not Available	1659
3300012273|Ga0126329_10117679	Not Available	1412
3300012273|Ga0126329_10149508	Not Available	1217
3300012273|Ga0126329_10275986	Not Available	771
3300012273|Ga0126329_10293475	Not Available	732
3300012273|Ga0126329_10300072	Not Available	719
3300012273|Ga0126329_10328847	Not Available	664
3300012273|Ga0126329_10341366	Not Available	643
3300012273|Ga0126329_10404475	Not Available	555
3300012887|Ga0126335_1136641	Not Available	947
3300027519|Ga0209562_1026827	Not Available	3475
3300027519|Ga0209562_1273238	Not Available	599
3300027550|Ga0209255_1306425	Not Available	711
3300027550|Ga0209255_1356882	Not Available	611
3300027550|Ga0209255_1387338	Not Available	557
3300027624|Ga0209789_10131218	Not Available	980

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	99.08%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	0.92%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	99.08%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	0.92%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms	89.91%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	9.17%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	0.92%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300003786	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2	Host-Associated
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated
3300004632	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1	Host-Associated
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated
3300012887	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG	Host-Associated
3300027519	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes)	Host-Associated
3300027550	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)	Host-Associated
3300027624	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0049116_100160122	3300003786	Marine Gutless Worms Symbiont	MVSFVFPGENGRDLGIAGWEHMGMGMGFKFQVGMGMGWEWE*
JGI26667J51740_100251401	3300003906	Marine Gutless Worms Symbiont	DVSFELPDGNGMDLENAEWKNMGMRFKFQMGIGIGWEWE*
Ga0049105_11591351	3300004630	Marine Gutless Worms Symbiont	DISFELPDGNGRYLEIAELENMGMGFKFQMGMAMEWEWE*
Ga0049105_12680491	3300004630	Marine Gutless Worms Symbiont	LRVSFELPDENGRDLGIAGWENMGMRFKFKMGMGMGWEWE*
Ga0049107_101671393	3300004632	Marine Gutless Worms Symbiont	LFVRSDVSFELPDGNGNGRDLGIAGWEKMGMGFKFQMGMGVGWEWE*
Ga0126333_10334533	3300010290	Marine Gutless Worms	ELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126333_10760322	3300010290	Marine Gutless Worms	HDVSFELPDGNGRDSGIAGWENMGMEFKLQMGMGMGWEWEWE*
Ga0126333_10820831	3300010290	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQMGMGMKSLK*
Ga0126333_10874991	3300010290	Marine Gutless Worms	VSFELPDGNGRDSGIAGWENMGMGFKFQMGMGMGWKWE*
Ga0126333_11548402	3300010290	Marine Gutless Worms	LPGGNGRDSGIAGWENMGMGFKFQMGMGVGWEWE*
Ga0126333_11676861	3300010290	Marine Gutless Worms	LPDGNGRDSGIAGWENMGMGFKFQMGMGMGWEWELSH*
Ga0126333_11824171	3300010290	Marine Gutless Worms	SFELPGGNGRDSGIAGWENMGMGFKFQTGMGMGWEWE*
Ga0126333_11955721	3300010290	Marine Gutless Worms	HDVSFELPDGNGRDSGIAGWENMGMEFKLQMGMGMGWEWE*
Ga0126333_12749302	3300010290	Marine Gutless Worms	ELPGGNGRDSGIAGWENMGMGFKFQTGMGMGWEWE*
Ga0126326_12098601	3300010292	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKYQMGMGMGWE*
Ga0126326_12196951	3300010292	Marine Gutless Worms	VNVYSNVSFELPGGNGRESGIAGWENMGMGFKFQTGMRMGWEWE*
Ga0126326_12275531	3300010292	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126326_12376412	3300010292	Marine Gutless Worms	HDVSFELPGGNERDSGIAGWENMEMGFKFQMGMGMGWEWE*
Ga0126326_12442771	3300010292	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQMGMRMGWERE*
Ga0126326_12927662	3300010292	Marine Gutless Worms	SFELPGVNGRDSGIAVWENMGMGFKFQMGMGMGWEWE*
Ga0126332_100148034	3300010294	Marine Gutless Worms	SFELPGGNGRDSGIAGWENMGMGFKFQTGMGWEWE*
Ga0126332_100687171	3300010294	Marine Gutless Worms	MMSFFELPGGNGRDSGIAGWENMGMGFKFHMGMGMGWEWE*
Ga0126332_100759361	3300010294	Marine Gutless Worms	SFELPGGNERDSGIAGWENMGMGFKFQMGMGWERE*
Ga0126332_100810831	3300010294	Marine Gutless Worms	DVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126332_100828763	3300010294	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126332_100891011	3300010294	Marine Gutless Worms	LPDGNGRDSGIAGWENMGMGFKFQMGMGMKSLKWEGIGTKN
Ga0126332_101145691	3300010294	Marine Gutless Worms	SFELPGGNGRDLGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126332_101375011	3300010294	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMRFKFQMGMGMGREWK*
Ga0126332_101405411	3300010294	Marine Gutless Worms	DVSFELPGGNGRDSGIAGWENMGMGFKFQTGMGMEWE*
Ga0126332_101544434	3300010294	Marine Gutless Worms	SFELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126332_101736541	3300010294	Marine Gutless Worms	LPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126332_102097211	3300010294	Marine Gutless Worms	FELPGGNGRESGIDGWENMGMGFKFQMGMGMGWEW*
Ga0126332_102309271	3300010294	Marine Gutless Worms	ELPGGNGRDSGIAGWENMGMGFKFQMGMGVGWEWE*
Ga0126332_102401381	3300010294	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGKGWEWE*
Ga0126332_103707271	3300010294	Marine Gutless Worms	LPGGNGRDSGIAGWENMGMGLKFQTGMGMGWEWE*
Ga0126332_103756351	3300010294	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEPE*
Ga0126334_100366451	3300010295	Marine Gutless Worms	LPGRNGRDSGIAGWEDMGMGFKFQVGMEMGIKSLKWE
Ga0126334_100527211	3300010295	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMGFKFQMGMGWERE*
Ga0126334_100651401	3300010295	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQKGMGMGWEWE*
Ga0126334_101421781	3300010295	Marine Gutless Worms	FELPGGNGRDSGIAGWENTGMGFKFQMGMGWEWE*
Ga0126334_102178201	3300010295	Marine Gutless Worms	DVSFELPGGNGRDSGIAGWENMGMGFKFLTGMGMGWE*
Ga0126334_102290801	3300010295	Marine Gutless Worms	VSFELPGGNGRDSRIAGWENMGMGFKFQMGMGWEWE*
Ga0126334_102658241	3300010295	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQTGVGMGWEWE*
Ga0126334_103285851	3300010295	Marine Gutless Worms	MMSHFELPGGNGMDSGIAGWENMGMGFKFQTGMGM
Ga0126334_104035241	3300010295	Marine Gutless Worms	AYHDVSFELPGGNGRDSGIAGWENMGMGFKFQMEMGWEWE*
Ga0126334_104261671	3300010295	Marine Gutless Worms	SFALPGGNGRDSGIAGWENMGMGFKFQMGMGMGWGWE*
Ga0126325_101447961	3300010298	Marine Gutless Worms	DVSFELPGGNGRDSGIAGWENMGMGFKFQTGMGIGWEWE*
Ga0126325_101593771	3300010298	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGKGWERE*
Ga0126325_101658971	3300010298	Marine Gutless Worms	NVSFELPGGNGRDSGIAGWENMGMGFKFQVGMGWERE*
Ga0126325_101820201	3300010298	Marine Gutless Worms	LPGGNERDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126325_101858632	3300010298	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQTGMGWEWE*
Ga0126325_102205181	3300010298	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMRMGIGWEWE*
Ga0126325_102382571	3300010298	Marine Gutless Worms	FELPGGNGRDSGIAEWENMGMGFKFQMGMGWEWE*
Ga0126325_102725192	3300010298	Marine Gutless Worms	FPTFCAQHDVSFELPGGNGRDSGIAGWENMGMGFKFQIGMGMG*
Ga0126325_103774733	3300010298	Marine Gutless Worms	SFELPDGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126331_10316553	3300010314	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMGFKFHMGMGMGWEWE*
Ga0126331_10596271	3300010314	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGWE*
Ga0126331_11118492	3300010314	Marine Gutless Worms	SFELPGGNGRDSGIAGWENMGMGFKFQVGMGMGWEWE*
Ga0126331_11234831	3300010314	Marine Gutless Worms	FELPDGNGRDSGIAGWENMGMEFKLQMGMGMGWEWE*
Ga0126331_11809303	3300010314	Marine Gutless Worms	SFELPGGNGRDSGIDGWENMGMGFKFQMGMGMGWEWE*
Ga0126331_12026031	3300010314	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQMGMGTGWEWE*
Ga0126331_12349421	3300010314	Marine Gutless Worms	VLFELPGGNGRDSGIAGWENMGMGFKFQMGMGWERE*
Ga0126331_13354531	3300010314	Marine Gutless Worms	DVSFELPDGNGRDSGIAGWENMGMGFKFQMGMGMGWEWK*
Ga0136654_10922135	3300010315	Marine Gutless Worms	HDVSFELPGGNGRDLGIAGWENMGMGFKFQTGMGMRWEWE*
Ga0136654_11375331	3300010315	Marine Gutless Worms	HDVSFELPGGNGRDSGIARWENMGMGIKFQMGMGMEWE*
Ga0136654_11411482	3300010315	Marine Gutless Worms	SFELPGGNGRDSGIAGWENMGMGFKFQMEMGWEWE*
Ga0136654_11519512	3300010315	Marine Gutless Worms	LQDGNGRDSGIAGWENMGMGFKFQMGMGMKSLKWEGI
Ga0136654_11678251	3300010315	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFEMGMGMKSLK*
Ga0136654_11878681	3300010315	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0136654_11985241	3300010315	Marine Gutless Worms	MPSGNGRDSGIAGWENMGMGFKFQTAMEMGWEWE*
Ga0136654_12029541	3300010315	Marine Gutless Worms	QHDVSFELPGGNGRDSGIARWINVGMGFKFQMGMGMGWEWEGSH*
Ga0136654_12383271	3300010315	Marine Gutless Worms	FELSGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0136654_12580201	3300010315	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMAMGWEWE*
Ga0126328_100516912	3300010377	Marine Gutless Worms	FELPGGNGRDSGIAGRENMGMGFKFQMGMGKGWEWE*
Ga0126328_100807444	3300010377	Marine Gutless Worms	FELPGGNGRDSGIVGWENMGMGFKFQMGMEMGWERE*
Ga0126328_102474881	3300010377	Marine Gutless Worms	VSFDLPGGNGRDSGIAGGENMGMGIKFQMGMGWEWE*
Ga0126328_102765491	3300010377	Marine Gutless Worms	HDVSFELPGGNGRGSGIAGWENMRMGFKFQTGMGMGWEWE*
Ga0126328_103405061	3300010377	Marine Gutless Worms	FELPGGNGTDLEIAGWENMGMGFKFQMGMGMGWE*
Ga0126330_100067161	3300010378	Marine Gutless Worms	SMMSHLTRFNLPGGNGRDSGTDGWENMGMGFKFQMGMGWEWE*
Ga0126330_100346791	3300010378	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGLKFQTGMGMGWEWE*
Ga0126330_100902431	3300010378	Marine Gutless Worms	ELPGGNGRDSGIAGWENMGIGFKFQMGMGMGWEWECSH*
Ga0126330_101057561	3300010378	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQKGMAMGWEWE*
Ga0126330_101106351	3300010378	Marine Gutless Worms	LPGGNGRDSGIAGWENMGMGFKFQTGMGMGWEWE*
Ga0126330_101378693	3300010378	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMGFKFQTGMGMGWEWE*
Ga0126330_101480601	3300010378	Marine Gutless Worms	FELPGGNGRDSGIAGWENMRMGFKFQMGMGWEWE*
Ga0126330_102373711	3300010378	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMEFKFQMGMGMRWKWE*
Ga0126330_103935342	3300010378	Marine Gutless Worms	SFELPGGNGRDSGITGWENMGMGFKFQMGMGWEWE*
Ga0126327_100654892	3300011190	Marine Gutless Worms	SFELPGGNGRDSGIAGWENMGMGFKFQTGMGMGWERE*
Ga0126327_101479181	3300011190	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMVMGWEWE*
Ga0126327_102182832	3300011190	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMRMGWERE*
Ga0126327_103188841	3300011190	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGWERE*
Ga0126327_103638791	3300011190	Marine Gutless Worms	ELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWERERSH*
Ga0126329_100425903	3300012273	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMGFKFQMGMGWEWE*
Ga0126329_100883061	3300012273	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQVGMGMG*
Ga0126329_101176791	3300012273	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGWEWE*
Ga0126329_101495082	3300012273	Marine Gutless Worms	LHDVSFELPGGNERDSGIAGWENMGMGFKFQMGMGMGWEWE*
Ga0126329_102759861	3300012273	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMEMEWE*
Ga0126329_102934751	3300012273	Marine Gutless Worms	ELPGGNGRDSGIAGWENMGMGFKFQMGMGMGWEWV*
Ga0126329_103000721	3300012273	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGWERD*
Ga0126329_103288471	3300012273	Marine Gutless Worms	HDVSFELPGGNGRDSGIAGWENMGMGFKFQMGMGVGWEWE*
Ga0126329_103413661	3300012273	Marine Gutless Worms	FELPGGNGRDSGIAGWENMGMGFKFQKGMAMGWERE*
Ga0126329_104044751	3300012273	Marine Gutless Worms	VSFALPGGNGKDSGIAGWENMGMGFKFQTGMGMGWEW
Ga0126335_11366411	3300012887	Marine Gutless Worms	VSFELPGGNGRDSGIAGWENMGMGFKFQMGVGMGWEWK*
Ga0209562_10268274	3300027519	Marine Gutless Worms Symbiont	MVSFVFPGENGRDLGIAGWEHMGMGMGFKFQVGMGMGWEWE
Ga0209562_12732383	3300027519	Marine Gutless Worms Symbiont	YNVSFELPNRNGRDLGIAGWKNMGMGFKFQMGMGIGWEWERSH
Ga0209255_13064252	3300027550	Marine Gutless Worms Symbiont	VSYEFPDGNGRYLIIAGWENMGMGFKFQMGMGMKSLKWE
Ga0209255_13568821	3300027550	Marine Gutless Worms Symbiont	YDISFELPDGNGRYLEIAELENMGMGFKFQMGMAMEWEWE
Ga0209255_13873381	3300027550	Marine Gutless Worms Symbiont	MFELPGGNGRILGIAGQENMGLGLNGNGMGMKSLNWE
Ga0209789_101312181	3300027624	Marine Gutless Worms Symbiont	HSMMCRFELQDGNGRDMGIAGWENMGMGFKFQMGMGMGWEWE