Metagenome Family F087981

Overview

Basic Information

• Family ID: F087981
• Family Type: Metagenome
• Number of Sequences: 109
• Average Sequence Length: 42 residues
• Representative Sequence: KRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
• Number of Associated Samples: 18
• Number of Associated Scaffolds: 109

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.85 %
• % of genes near scaffold ends (potentially truncated): 52.29 %
• % of genes from short scaffolds (< 2000 bps): 58.72 %
• Associated GOLD sequencing projects: 18
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (42.202 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (83.486 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (77.982 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 57.14%
  β-sheet: 0.00%
  Coil/Unstructured: 42.86%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF14111	DUF4283	1.83
PF00612	IQ	0.92
PF08284	RVP_2	0.92
PF00254	FKBP_C	0.92
PF13952	DUF4216	0.92
PF14432	DYW_deaminase	0.92
PF09337	zf-H2C2	0.92
PF03732	Retrotrans_gag	0.92
PF03641	Lysine_decarbox	0.92
PF07727	RVT_2	0.92
PF02992	Transposase_21	0.92
PF00069	Pkinase	0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.67
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	0.92

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.80 %
Unclassified	root	N/A	42.20 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.96 %
Unclassified	root	N/A	42.20 %
Viruses	superkingdom	All Organisms → Viruses	1.83 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	35.78 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	20.18 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	35.78 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	19.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.92 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	35.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	19.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.92 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	33.94 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.92 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.92 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	33.94 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.92 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	0.92 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	26.61 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.92 %
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	0.92 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	26.61 %
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	0.92 %
Sphingobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae	0.92 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %
unclassified Sphingobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae	0.92 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	25.69 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	24.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.92 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	24.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.92 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	24.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.92 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	21.10 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.92 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.92 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300028786|Ga0307517_10008020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	15232
3300028786|Ga0307517_10010492	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12962
3300028786|Ga0307517_10014123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10766
3300028786|Ga0307517_10025811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7159
3300028786|Ga0307517_10050659	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4214
3300028786|Ga0307517_10057100	Not Available	3790
3300028786|Ga0307517_10126365	Not Available	1863
3300028786|Ga0307517_10148926	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1613
3300028786|Ga0307517_10159351	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1520
3300028786|Ga0307517_10191505	Not Available	1297
3300028786|Ga0307517_10196844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1267
3300028786|Ga0307517_10299183	Not Available	903
3300028786|Ga0307517_10361770	Not Available	783
3300028786|Ga0307517_10454691	Not Available	662
3300028786|Ga0307517_10581253	Not Available	555
3300028794|Ga0307515_10022337	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	11155
3300028794|Ga0307515_10046438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6637
3300028794|Ga0307515_10085928	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4018
3300028794|Ga0307515_10179026	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2078
3300028794|Ga0307515_10201829	Not Available	1861
3300028794|Ga0307515_10241947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1573
3300028794|Ga0307515_10274987	Not Available	1399
3300028794|Ga0307515_10412855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	972
3300028794|Ga0307515_10592966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	718
3300030521|Ga0307511_10016043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7236
3300030521|Ga0307511_10028288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5094
3300030521|Ga0307511_10042228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3834
3300030521|Ga0307511_10051464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3302
3300030521|Ga0307511_10071210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2538
3300030521|Ga0307511_10127279	All Organisms → Viruses → Predicted Viral	1548
3300030521|Ga0307511_10282600	Not Available	766
3300030521|Ga0307511_10347995	Not Available	638
3300030522|Ga0307512_10012450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	8031
3300030522|Ga0307512_10030132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4727
3300030522|Ga0307512_10112680	Not Available	1783
3300030522|Ga0307512_10159816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1323
3300030522|Ga0307512_10181477	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	1181
3300030522|Ga0307512_10210230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1036
3300030522|Ga0307512_10211229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1031
3300030522|Ga0307512_10269153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	827
3300030522|Ga0307512_10413476	Not Available	560
3300030522|Ga0307512_10415090	Not Available	558
3300031456|Ga0307513_10023865	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7133
3300031456|Ga0307513_10042255	Not Available	5021
3300031456|Ga0307513_10070254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3660
3300031456|Ga0307513_10746341	Not Available	684
3300031507|Ga0307509_10036161	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5411
3300031507|Ga0307509_10221312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1705
3300031507|Ga0307509_10275204	Not Available	1448
3300031507|Ga0307509_10312612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1312
3300031507|Ga0307509_10594674	Not Available	779
3300031507|Ga0307509_10667316	Not Available	707
3300031616|Ga0307508_10055061	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3524
3300031616|Ga0307508_10062113	Not Available	3298
3300031616|Ga0307508_10076251	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2930
3300031616|Ga0307508_10150451	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	1932
3300031616|Ga0307508_10193124	Not Available	1637
3300031616|Ga0307508_10196455	Not Available	1618
3300031616|Ga0307508_10200476	Not Available	1596
3300031616|Ga0307508_10337214	Not Available	1099
3300031616|Ga0307508_10413904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	939
3300031616|Ga0307508_10448085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	883
3300031616|Ga0307508_10579197	Not Available	722
3300031616|Ga0307508_10739968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	595
3300031649|Ga0307514_10056377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3016
3300031649|Ga0307514_10065063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2763
3300031649|Ga0307514_10137964	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1664
3300031649|Ga0307514_10312229	Not Available	870
3300031649|Ga0307514_10551638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	531
3300031730|Ga0307516_10017908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7377
3300031730|Ga0307516_10239756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1512
3300031730|Ga0307516_10377913	Not Available	1078
3300031730|Ga0307516_10450482	Not Available	943
3300031730|Ga0307516_10637451	Not Available	720
3300031730|Ga0307516_10742462	Not Available	640
3300031838|Ga0307518_10066796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2608
3300031838|Ga0307518_10180175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1429
3300032354|Ga0325403_1000274	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	32553
3300032354|Ga0325403_1003050	Not Available	15123
3300032354|Ga0325403_1035732	Not Available	3978
3300032354|Ga0325403_1070891	Not Available	1961
3300032355|Ga0325401_1033719	All Organisms → Viruses → Predicted Viral	4399
3300032355|Ga0325401_1033827	Not Available	4388
3300032355|Ga0325401_1130985	Not Available	1113
3300032374|Ga0325400_1017506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6778
3300032374|Ga0325400_1030188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	4900
3300032374|Ga0325400_1040009	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4059
3300032374|Ga0325400_1045031	Not Available	3720
3300032374|Ga0325400_1197742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	907
3300032389|Ga0325405_1001557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	23342
3300032389|Ga0325405_1033841	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3803
3300032389|Ga0325405_1074560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1419
3300032390|Ga0325404_1029269	Not Available	4368
3300032390|Ga0325404_1065796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1656
3300033179|Ga0307507_10010419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12020
3300033179|Ga0307507_10162395	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1647
3300033179|Ga0307507_10179395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1517
3300033179|Ga0307507_10205591	Not Available	1353
3300033179|Ga0307507_10238905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1192
3300033179|Ga0307507_10240519	Not Available	1185
3300033179|Ga0307507_10325262	Not Available	922
3300033179|Ga0307507_10471920	Not Available	685
3300033179|Ga0307507_10529264	Not Available	627
3300033179|Ga0307507_10585572	Not Available	580
3300033180|Ga0307510_10033141	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5806
3300033180|Ga0307510_10111903	Not Available	2469
3300033180|Ga0307510_10373361	Not Available	872
3300034389|Ga0325419_012614	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	8518

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	83.49%
Wood	Host-Associated → Plants → Wood	15.60%
Phylloplane	Host-Associated → Plants → Phylloplane	0.92%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	83.49%
Unclassified	Host-Associated → Plants → Wood → Unclassified	15.60%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.92%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	83.49%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	15.60%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.92%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	83.49%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	15.60%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	0.92%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100080201	3300028786	Ectomycorrhiza	RNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307517_1001049210	3300028786	Ectomycorrhiza	MNKRNINRLDKNIVMMKNVNKRLMKAELKHYKITKKENKSKILMXKQICLHVWKMPPFIG
Ga0307517_100141234	3300028786	Ectomycorrhiza	MNKRNINRLDKNIVTIKNINKRLMKAELKHYKITKKENKSKILI
Ga0307517_100258111	3300028786	Ectomycorrhiza	NKLDKNIVMIKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307517_100506597	3300028786	Ectomycorrhiza	INKLDKNIVMMKNINKRLMKAKLKHYKNIKKESKNMILI
Ga0307517_100571004	3300028786	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLMKAELKHYKITKKENKSKILILKPRCPNA
Ga0307517_101263651	3300028786	Ectomycorrhiza	MNKRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307517_101489261	3300028786	Ectomycorrhiza	MIKKRNINKLDKNIFMMKIINKILMRAKLKHYKNIKRESKNMILIGKL
Ga0307517_101593511	3300028786	Ectomycorrhiza	MIKKRNINEVDKNIFMMKSIKKRLMRAQLKHYKNTKKESKNMILI
Ga0307517_101915051	3300028786	Ectomycorrhiza	MNKININKLDKNIVMMKNINKRLMKEKLKHYKNTKKESKNMILI
Ga0307517_101968441	3300028786	Ectomycorrhiza	MIKKRNINKLDKNIVMMKGINKRLMIAKLKHYKNTKKESKNMILI
Ga0307517_102991832	3300028786	Ectomycorrhiza	LNIMKKKNINKLDKNIVMMKSINKRLMKAKLKHYKI
Ga0307517_103617701	3300028786	Ectomycorrhiza	RNINKLHKNIVMMKSINKRLMKAKLKQYKNTKKESKNMILI
Ga0307517_104546911	3300028786	Ectomycorrhiza	KRNINKLDKNIVMMKSINKRLMKAKLKHYKTTKKESKNMILI
Ga0307517_105812531	3300028786	Ectomycorrhiza	VNKRNINKLDKNIVMIKSINKRLIKAKLKHYKNTKKEELRRLIHQ
Ga0307515_100223371	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKSINKRLMRAKLKHYKNIKKESKNMILI
Ga0307515_1004643813	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKIINKILMRAKLKYYKNIKKESKNMILI
Ga0307515_100859284	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKIINKILMRAKLKHYKNIKRESKNMILIGKL
Ga0307515_101790263	3300028794	Ectomycorrhiza	MNKRNINKLDKNIVIMKSINKILMKAKLKHYKNTKKESKNMILI
Ga0307515_102018291	3300028794	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINNRLMKAKLKHYKNTKKESKNMILI
Ga0307515_102419471	3300028794	Ectomycorrhiza	KRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307515_102749871	3300028794	Ectomycorrhiza	IVKKRNINKLDKNIVIMKSINKRLIIKTKLKHYKNIKKESKYMILI
Ga0307515_104128551	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKIINKILMRAKLKHYKNIKRERART
Ga0307515_105929661	3300028794	Ectomycorrhiza	KKLDKNIVMMKSINKRLIRAKLKHYKNTKKESKCMILI
Ga0307511_100160432	3300030521	Ectomycorrhiza	MKKININKLDKNIIMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307511_100282881	3300030521	Ectomycorrhiza	MNKRNINRLDKNIVMMKNVNKRLMKAELKHYKITKKENKSKILK
Ga0307511_100422285	3300030521	Ectomycorrhiza	KLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307511_100514641	3300030521	Ectomycorrhiza	NINKQDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307511_100712101	3300030521	Ectomycorrhiza	INKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307511_101272791	3300030521	Ectomycorrhiza	MKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKE
Ga0307511_102826001	3300030521	Ectomycorrhiza	MKKKNINKLDKNIVMMKSINKRLMKAKLRHYRNIKKESKNIILI
Ga0307511_103479951	3300030521	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLMKAELKHYKITKKENKSKILILK
Ga0307512_100124501	3300030522	Ectomycorrhiza	MKKKNINELDKNIVMIKSINKRLMKAKLKHYKNSD
Ga0307512_100301321	3300030522	Ectomycorrhiza	VNKRNINKLDKNIVMMKSINKRLMKAKLKHYKNAKKKS
Ga0307512_101126801	3300030522	Ectomycorrhiza	NINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307512_101598161	3300030522	Ectomycorrhiza	DKNIVMIKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307512_101814771	3300030522	Ectomycorrhiza	KKNINKLDKNIVMMKSINKRLMKAKLKHYKNIKKEELSVVG
Ga0307512_102102302	3300030522	Ectomycorrhiza	MKKKNINKLDMNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307512_102112291	3300030522	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLLKAKLKHYKITKKKNKS
Ga0307512_102691531	3300030522	Ectomycorrhiza	LDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307512_104134762	3300030522	Ectomycorrhiza	MKKNNINKLDKNIVMMKSINKRLMKVKLKHYKNIKKESKNMILI
Ga0307512_104150901	3300030522	Ectomycorrhiza	KNINKLDKNIVMMKIINKRLMKAELKHYKDIKKESKNMILI
Ga0307513_100238659	3300031456	Ectomycorrhiza	MEKRNINKLDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307513_100422552	3300031456	Ectomycorrhiza	MKKININKLDKNIVMMKSINKRLIKVKLKHYKNTKKESKNMILI
Ga0307513_100702541	3300031456	Ectomycorrhiza	DKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307513_107463411	3300031456	Ectomycorrhiza	VKKRNINKLDMNIVMMKSINKRLMKARLKHYKNTK
Ga0307509_100361614	3300031507	Ectomycorrhiza	MNKRNINRLDKNIVMMKNVNKRLMKAELKHYKITKKENKSKILM
Ga0307509_102213123	3300031507	Ectomycorrhiza	INKLDKNIVMMKSINKRLMRAKLKHYKNIKKESKNMILI
Ga0307509_102752041	3300031507	Ectomycorrhiza	KQDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307509_103126123	3300031507	Ectomycorrhiza	MIKKRIINKLDKNIVMMKGINKRLMKAKLMHYKNIKKESKNMIWI
Ga0307509_105946741	3300031507	Ectomycorrhiza	NKLDKNIVMMKNINKRLMKAKLKHYKNTKKESKNMILI
Ga0307509_106673161	3300031507	Ectomycorrhiza	NINKLDKNIVMMKNINKRLMKAKLKHYKNIKKESKNMILI
Ga0307508_100550613	3300031616	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLMKTKLKHYKITKKENKSKILI
Ga0307508_100621132	3300031616	Ectomycorrhiza	MNKRNINRLDKNIVKMKNINKRLMKAELKHYKITKKENKSNILI
Ga0307508_100762517	3300031616	Ectomycorrhiza	LNIVKKRNINKLDMNIVMMKSINKRLMKARLKHYKNTKKENKNMILI
Ga0307508_101504511	3300031616	Ectomycorrhiza	MNKRNINKLDKNIVVMKSINKILMKAKHKHYKNTKKESKNMILI
Ga0307508_101931241	3300031616	Ectomycorrhiza	MIKNRNINKLDKNIVMMKNINKRLMRAKLKHYKNTKK
Ga0307508_101964551	3300031616	Ectomycorrhiza	MKKKNINELDKNIVMMKSINKRLMKAKLNHYKNIKKESKNMILI
Ga0307508_102004761	3300031616	Ectomycorrhiza	QEKNIVMMKSINKRLMKAKFKHYKNIKKESKNMILISKPR
Ga0307508_103372142	3300031616	Ectomycorrhiza	KININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNVILI
Ga0307508_104139041	3300031616	Ectomycorrhiza	MKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNVIL
Ga0307508_104480851	3300031616	Ectomycorrhiza	MNKRNINRLDKNIVKMKNINKRLMKTELKHYKITKKVNKSNILI
Ga0307508_105791971	3300031616	Ectomycorrhiza	RNMNKLDKNIVMMKSINKRLMKAKLKHYKNTNKESKNMILI
Ga0307508_107399681	3300031616	Ectomycorrhiza	MIKKRNINKLDKNIVMMKSINKRLMRAKLEHYKSTKKESNNMILI
Ga0307514_100563771	3300031649	Ectomycorrhiza	MNKRNINRLDKNVVMMKNVNKRLMKAELKHYKITKKENKSKILI
Ga0307514_100650632	3300031649	Ectomycorrhiza	MNKRNINRLNKNIVTIKNINKRLMKAELKHYKIIKKENKSKILI
Ga0307514_101379641	3300031649	Ectomycorrhiza	MIKKRNINKLDRNIVTMKSINKRLMRAKLKHYKNTKKESKNMILI
Ga0307514_103122292	3300031649	Ectomycorrhiza	KLDKNIVMMKSINKRLMKTKLKHYKNRKKESKNMILI
Ga0307514_105516382	3300031649	Ectomycorrhiza	NKLDKNIVMIKSINKRLMKAKLKHYKNTKKKSKNMILI
Ga0307516_100179081	3300031730	Ectomycorrhiza	MIKKRNINKLDKNIVIMKSINKRLMGAKLKHYKNIKKESKNMILI
Ga0307516_100675532	3300031730	Ectomycorrhiza	MIKKRIINKLDKNIVMMKSINKRLLXAQLKHYKNIKKKRARTXSXSENQDA
Ga0307516_102397562	3300031730	Ectomycorrhiza	KIDMNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307516_103779132	3300031730	Ectomycorrhiza	KLDKNIVMMKNINKRLMKAKLKHYKNTKKESKNMILI
Ga0307516_104504823	3300031730	Ectomycorrhiza	MKKKNINKLDKNIVMMTSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307516_106374511	3300031730	Ectomycorrhiza	INKLDKNIVMMKSINKRLMKAKLKHYKNTRKKARI
Ga0307516_107424621	3300031730	Ectomycorrhiza	VKKRNINKLDKNIVMMKNINKRLMKAKLKHYKNTKKES
Ga0307518_100667962	3300031838	Ectomycorrhiza	LNMIKKRNINKLDKNIVMMKIINKILMRAKLKHYKNIKRESKNMILIGKL
Ga0307518_101801751	3300031838	Ectomycorrhiza	DKNIVMMKGINKRLMIAKLKHYKNTKKESKNMILI
Ga0325403_10002747	3300032354	Xylem	MKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0325403_10030504	3300032354	Xylem	MKKKNINKLDKNIVMMKDINKRLMKGKLKYYKNIMKESKNMILILKPR
Ga0325403_10357321	3300032354	Xylem	MNKRNINKLDKNIVMIKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0325403_10708911	3300032354	Xylem	MNKRNINRLDKNIVMMKNINKRLRKAELKHYKITKKENKSKILI
Ga0325401_10337191	3300032355	Xylem	MNKRNINRLDKNIVMMKNINKRLRKAELKHYKITKKENK
Ga0325401_10338271	3300032355	Xylem	MKKININKLDKNIVMMKIINKRLVKAKLKHYKNTRKESKNMILI
Ga0325401_11309851	3300032355	Xylem	LKIMNKRNINRLDKNIVMMKNINKRLRKAELKHYKITKKENKSKILI
Ga0325400_10175068	3300032374	Xylem	MKKININKLDKNIVMMKSINKRLMKAKIKHYKNTKKESKNMILI
Ga0325400_10301881	3300032374	Xylem	MSSVTNMIKKRNINKLDKNIIMMKSINKRLMRANLKHYKNTKKESKNMILI
Ga0325400_10400091	3300032374	Xylem	VNKRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKK
Ga0325400_10450314	3300032374	Xylem	MNKRNINKLDKNIVMIKSINKRLIKAKLKHYKNTKKESKNMILI
Ga0325400_11977421	3300032374	Xylem	MIKKRNIHKLDKNIVMMKSINKRLIRAKLKHNRNIKKESKNMILI
Ga0325405_10015575	3300032389	Xylem	MTKRNINRLDKNIVMMKNINKRIMKAELKHNKITKKENKRKILI
Ga0325405_10338414	3300032389	Xylem	NINKLDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0325405_10745601	3300032389	Xylem	NKLDKNIVTMKNINKRLMKAKLKHYKNIKKERKNMILI
Ga0325404_10292694	3300032390	Xylem	MKKININKLNKNIVMMKSINNRLMKAKLKHYKNTKKESKNMS
Ga0325404_10657962	3300032390	Xylem	MIKKRNIHKLDKNIVMMKSINKRLIRAKLKHYKNIKKESKNMILI
Ga0307507_100104192	3300033179	Ectomycorrhiza	MNKRNINRLDKNVVMMKNVNKRLMKAELKHYKITKKENKSKILM
Ga0307507_101623952	3300033179	Ectomycorrhiza	INKLHKNIVMMKSINKRLMKAKLKQYKNTKKESKNMILI
Ga0307507_101793951	3300033179	Ectomycorrhiza	MIKKRNINKLDKNIVMMKSINKRLMRAKLKHYKSTKKESNNMILI
Ga0307507_102055911	3300033179	Ectomycorrhiza	DKNIVIMKSINKRLMGAKLKHYKNIKKESKNMILI
Ga0307507_102389051	3300033179	Ectomycorrhiza	MIKKININKLDKNIVMMKSINKRLMRAKLKYYKNTKKESKNMILI
Ga0307507_102405192	3300033179	Ectomycorrhiza	MIKNRNINKLDNNIVMMKSINKRLMRAKLKHYKHTKKESKNMILI
Ga0307507_103252621	3300033179	Ectomycorrhiza	NIMKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNVILI
Ga0307507_104719202	3300033179	Ectomycorrhiza	KNINKLDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307507_105292641	3300033179	Ectomycorrhiza	NIMKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307507_105855721	3300033179	Ectomycorrhiza	NKRNINRLDKNIVMMKNINKRLMKAELKHYKITKKENKSKILI
Ga0307510_100331419	3300033180	Ectomycorrhiza	NMIKKRNINKLDKNIVMMKSINKRLMKAKLKHYIYIYRERESKNMILI
Ga0307510_101119035	3300033180	Ectomycorrhiza	KNIVMMKSINKRLMKAKLKHYKNIKKESKNMILISKPR
Ga0307510_103733611	3300033180	Ectomycorrhiza	DKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0325419_012614_3251_3388	3300034389	Leaf	MIKKRNINKLDKNIVMMKSTNKRLMGAKLKHYKNIKKESKNMILI