| Basic Information | |
|---|---|
| Family ID | F087948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 53 residues |
| Representative Sequence | LQYDVTVEDPNVWETPWVIPARTFPFRPELEFVSEFVCESTVDYQRLFKKN |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.818 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.86% β-sheet: 0.00% Coil/Unstructured: 91.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02771 | Acyl-CoA_dh_N | 12.73 |
| PF08028 | Acyl-CoA_dh_2 | 5.45 |
| PF02900 | LigB | 3.64 |
| PF13620 | CarboxypepD_reg | 3.64 |
| PF08308 | PEGA | 1.82 |
| PF00694 | Aconitase_C | 1.82 |
| PF04002 | RadC | 0.91 |
| PF02653 | BPD_transp_2 | 0.91 |
| PF00384 | Molybdopterin | 0.91 |
| PF00487 | FA_desaturase | 0.91 |
| PF02687 | FtsX | 0.91 |
| PF01757 | Acyl_transf_3 | 0.91 |
| PF09980 | DUF2214 | 0.91 |
| PF00005 | ABC_tran | 0.91 |
| PF01717 | Meth_synt_2 | 0.91 |
| PF01556 | DnaJ_C | 0.91 |
| PF13602 | ADH_zinc_N_2 | 0.91 |
| PF08281 | Sigma70_r4_2 | 0.91 |
| PF01493 | GXGXG | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 18.18 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.91 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.91 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.91 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.82 % |
| Unclassified | root | N/A | 28.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_101835719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300001372|YBBDRAFT_1122683 | Not Available | 550 | Open in IMG/M |
| 3300001848|RCM47_1135609 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300004013|Ga0055465_10229541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300004463|Ga0063356_101124358 | Not Available | 1134 | Open in IMG/M |
| 3300004463|Ga0063356_104905862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300004463|Ga0063356_105122391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300004643|Ga0062591_100975018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300005335|Ga0070666_11404303 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005347|Ga0070668_101094384 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 719 | Open in IMG/M |
| 3300005353|Ga0070669_100277938 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300005354|Ga0070675_101588219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005356|Ga0070674_101059210 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005365|Ga0070688_101557070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005440|Ga0070705_101833985 | Not Available | 515 | Open in IMG/M |
| 3300005456|Ga0070678_101442778 | Not Available | 643 | Open in IMG/M |
| 3300005564|Ga0070664_101332693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300005617|Ga0068859_100234876 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300005617|Ga0068859_101756859 | Not Available | 685 | Open in IMG/M |
| 3300005844|Ga0068862_100313086 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300006237|Ga0097621_102084245 | Not Available | 542 | Open in IMG/M |
| 3300006755|Ga0079222_12221357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006845|Ga0075421_100201543 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300006846|Ga0075430_100118554 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300006854|Ga0075425_102937257 | Not Available | 522 | Open in IMG/M |
| 3300006880|Ga0075429_100937756 | Not Available | 757 | Open in IMG/M |
| 3300006881|Ga0068865_101371628 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006881|Ga0068865_102170118 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006894|Ga0079215_10150098 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300006904|Ga0075424_101796751 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006969|Ga0075419_10021971 | All Organisms → cellular organisms → Bacteria | 3948 | Open in IMG/M |
| 3300006969|Ga0075419_10337934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1022 | Open in IMG/M |
| 3300007004|Ga0079218_10034578 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
| 3300009012|Ga0066710_104878426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300009094|Ga0111539_10533677 | Not Available | 1367 | Open in IMG/M |
| 3300009100|Ga0075418_11043010 | Not Available | 885 | Open in IMG/M |
| 3300009156|Ga0111538_10744859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1241 | Open in IMG/M |
| 3300009162|Ga0075423_12770155 | Not Available | 537 | Open in IMG/M |
| 3300009177|Ga0105248_11174724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300009609|Ga0105347_1178247 | Not Available | 844 | Open in IMG/M |
| 3300010044|Ga0126310_11203760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300010048|Ga0126373_11113768 | Not Available | 855 | Open in IMG/M |
| 3300010362|Ga0126377_10954152 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010362|Ga0126377_11211937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300010401|Ga0134121_11699763 | Not Available | 654 | Open in IMG/M |
| 3300010403|Ga0134123_10192464 | Not Available | 1728 | Open in IMG/M |
| 3300011432|Ga0137428_1088554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300012212|Ga0150985_106278471 | Not Available | 543 | Open in IMG/M |
| 3300012212|Ga0150985_111453998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300012358|Ga0137368_10619454 | Not Available | 686 | Open in IMG/M |
| 3300012469|Ga0150984_110076537 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300012469|Ga0150984_115414269 | Not Available | 580 | Open in IMG/M |
| 3300012469|Ga0150984_117763081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012511|Ga0157332_1075639 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012532|Ga0137373_10596178 | Not Available | 834 | Open in IMG/M |
| 3300012899|Ga0157299_10101552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 745 | Open in IMG/M |
| 3300012905|Ga0157296_10031897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300012914|Ga0157297_10027275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1336 | Open in IMG/M |
| 3300012971|Ga0126369_10589290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis | 1181 | Open in IMG/M |
| 3300013296|Ga0157374_11219174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300013308|Ga0157375_10725670 | Not Available | 1146 | Open in IMG/M |
| 3300013308|Ga0157375_11355715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300013308|Ga0157375_11458688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 807 | Open in IMG/M |
| 3300013308|Ga0157375_13045064 | Not Available | 559 | Open in IMG/M |
| 3300014272|Ga0075327_1240056 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 588 | Open in IMG/M |
| 3300014745|Ga0157377_11343388 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300014969|Ga0157376_10083688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2745 | Open in IMG/M |
| 3300015201|Ga0173478_10295321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300015245|Ga0137409_11510524 | Not Available | 520 | Open in IMG/M |
| 3300015372|Ga0132256_100104695 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300015373|Ga0132257_101764184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 794 | Open in IMG/M |
| 3300015374|Ga0132255_103732384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300016341|Ga0182035_11180232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300018079|Ga0184627_10194627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300018431|Ga0066655_11425057 | Not Available | 504 | Open in IMG/M |
| 3300018432|Ga0190275_12075475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300018469|Ga0190270_10528893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1131 | Open in IMG/M |
| 3300019377|Ga0190264_10980106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300022886|Ga0247746_1174710 | Not Available | 556 | Open in IMG/M |
| 3300023270|Ga0247784_1079082 | Not Available | 825 | Open in IMG/M |
| 3300025903|Ga0207680_10190167 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300025930|Ga0207701_11360275 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025931|Ga0207644_11029227 | Not Available | 691 | Open in IMG/M |
| 3300025938|Ga0207704_11098180 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025945|Ga0207679_11918833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300025986|Ga0207658_11987736 | Not Available | 529 | Open in IMG/M |
| 3300026088|Ga0207641_11686061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300027639|Ga0209387_1084002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300027691|Ga0209485_1162703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300027907|Ga0207428_10449108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300027909|Ga0209382_10922770 | Not Available | 917 | Open in IMG/M |
| 3300028608|Ga0247819_10269299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 943 | Open in IMG/M |
| 3300028802|Ga0307503_10676774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031231|Ga0170824_124529444 | Not Available | 591 | Open in IMG/M |
| 3300031712|Ga0265342_10666560 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031824|Ga0307413_11758862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300031847|Ga0310907_10511871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300031941|Ga0310912_10614135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300031943|Ga0310885_10891372 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031944|Ga0310884_10699088 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 613 | Open in IMG/M |
| 3300031947|Ga0310909_10164367 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300032004|Ga0307414_10159922 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300032005|Ga0307411_12240098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300032012|Ga0310902_10324315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 956 | Open in IMG/M |
| 3300032076|Ga0306924_10855844 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300032180|Ga0307471_101250162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300033412|Ga0310810_10419496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300034660|Ga0314781_040564 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.73% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.73% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.73% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.91% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1018357191 | 3300000956 | Soil | FQLKPDGNLQYEVTVEDPNVWQIPWKIAARTFSRRPELENVSEFVCESTVDYQRLFKQ* |
| YBBDRAFT_11226832 | 3300001372 | Marine Estuarine | GSLQYEVTVEDPNVWTRPWVIPARTFPFRPETEYVSEFVCDAPVVDYQKLFGKN* |
| RCM47_11356093 | 3300001848 | Marine Plankton | RRLDNGSLQYDVTVEDPNVWVSPWVMPQRTFALRPDLETVDEFVCESSQDYGKLFKKD* |
| Ga0055465_102295411 | 3300004013 | Natural And Restored Wetlands | LQYDVTVEDPNVWQTPWTIPTRTFQRRPEENVAEFVCESQVDYQRLFRK* |
| Ga0063356_1011243581 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LQYDVTVEDPNVWEKPWVIPTRTFPFRPEAEFVSEFVCESTVDYQRLFKE* |
| Ga0063356_1049058621 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ENGNLQYEVTVEDPNVWVRPWVIPARTFQRRPETEYVSEFVCDAPPVDYQKLFGKQ* |
| Ga0063356_1051223911 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VEDPNVWVRPWVIPARTFTFRPETEFVSEFVCDAPPVDYQKLFGK* |
| Ga0062591_1009750182 | 3300004643 | Soil | LSLQYEVTVEDPNVWQTPWAIPARTFPFRPELEWVSEFVCEPRVDYQKLFKKEP* |
| Ga0070666_114043031 | 3300005335 | Switchgrass Rhizosphere | VEDPNVWTTPWVIPARTFAGRPELDSVAEFVCESRVDYSKMFKK* |
| Ga0070668_1010943842 | 3300005347 | Switchgrass Rhizosphere | ENGNLQYDVTVEDPNVWAAPWVIPSRTFTHRPEAEWVDEFVCDAPPVDYQKLLGKD* |
| Ga0070669_1002779381 | 3300005353 | Switchgrass Rhizosphere | FRLLPDGNLQYDVTVEDPNVWQTPWVIPARTFQRRQELENVAEFVCESTVDYQRLFKK* |
| Ga0070675_1015882191 | 3300005354 | Miscanthus Rhizosphere | YDVTVEDPNVWAGPWVIPSRTFAFRPEAEWVEEFVCDTNVDYNKLFKKD* |
| Ga0070674_1010592102 | 3300005356 | Miscanthus Rhizosphere | LQYDVTVEDPEVFAAPWVIPARTFVLRPETEWVEEFVCESNVDYNKLFKK* |
| Ga0070688_1015570701 | 3300005365 | Switchgrass Rhizosphere | DVTVEDPNVWQAPWVIPARTFQRRSELENVAEFVCESTVDYQRLFKK* |
| Ga0070705_1018339852 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LENGSLQYEVTVEDPNVWVAPWAIPARTFQRQPQTEFVSEFVCDAPPVDYQKLFGKQ* |
| Ga0070678_1014427781 | 3300005456 | Miscanthus Rhizosphere | GSLQYEVTVEDPNVWVKPWDIPARTFAFRPETEFVSEFVCDAPVVDYQKLFGKTDK* |
| Ga0070664_1013326932 | 3300005564 | Corn Rhizosphere | QYEVTVEDPNVWQNPWKIAARTFPRRQELENVSEFVCESTVDYQRLFKQ* |
| Ga0068859_1002348763 | 3300005617 | Switchgrass Rhizosphere | PDGNLQYDVTVEDPNVWQAPWVIPARTFQRRSELENVAEFVCESTVDYQRLFKK* |
| Ga0068859_1017568592 | 3300005617 | Switchgrass Rhizosphere | EVTVEDPNVWVRPWAIPARTFQLRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0068870_108134202 | 3300005840 | Miscanthus Rhizosphere | PNVWQTPWKIAARTFPRRSELENVSEFVCESTVDYQRLFKQ* |
| Ga0068862_1003130861 | 3300005844 | Switchgrass Rhizosphere | ERFRLLPDGNLQYDVTVEDPNVWQTPWVIPARTFQRRQELENVAEFVCESTVDYQRLFKK |
| Ga0097621_1020842451 | 3300006237 | Miscanthus Rhizosphere | LQYEVTVEDPNVWVKPWVIPARTFAFRPETEFVSEFVCDAPVVDYQKLFGKTDK* |
| Ga0079222_122213571 | 3300006755 | Agricultural Soil | DPNVWQTPWKIAARTFPRRAELENVSEFVCESTVDYQRLFKQ* |
| Ga0075421_1002015433 | 3300006845 | Populus Rhizosphere | YEVTVEDPNVFAAPWVIPARTFALRPELEWVEEFVCETNVDYNKYFKKD* |
| Ga0075430_1001185541 | 3300006846 | Populus Rhizosphere | NLQYDVTVDDPNVWETAWVIPSRTFLFRSELESVSEFVCESTVDYQRLFKK* |
| Ga0075431_1020249382 | 3300006847 | Populus Rhizosphere | NVWEQPWAIPPRTFPLRPELEFVAEFVCESTVDYQRLFKK* |
| Ga0075425_1029372572 | 3300006854 | Populus Rhizosphere | ERFKRLENGNLQYDVTVEDPNVWVGPWTIPTRTFALRPEAEWVEEFVCDTNVDYDKLFKKN* |
| Ga0075429_1009377561 | 3300006880 | Populus Rhizosphere | ENGNLQYDVTVEDPNVWETPWVIPSRTFPFRPELESVSEFVCESTVDYQRLFKK* |
| Ga0068865_1013716281 | 3300006881 | Miscanthus Rhizosphere | KKLENGSLQYEVTVEDPNVWVRPWVIPARTFALRAETEYVSEFVCDAPVVDYQKLFEKK* |
| Ga0068865_1021701181 | 3300006881 | Miscanthus Rhizosphere | KLDNGNLQYDVTVDDPNVWEKPWVIPARTFALRPEIEFVSEFVCESTVDYQRLFKR* |
| Ga0079215_101500981 | 3300006894 | Agricultural Soil | NGSLQYDVTVEDPNVWEKPWVIPPRTFAFRPELEFVSEFVCESTVDYGRLFKKD* |
| Ga0075424_1017967513 | 3300006904 | Populus Rhizosphere | ERFRKLENGNLQYDVTVEDPNVWQTPWVIPARTFAFRPEFETVSEFVCESTVDYQRLFKK |
| Ga0075419_100219714 | 3300006969 | Populus Rhizosphere | KMETGDLQYDVTVEDPNVWEKPWVIPARTFPYRPELEFVSEFVCESTVDYQRLFKK* |
| Ga0075419_103379342 | 3300006969 | Populus Rhizosphere | TVEDPNVWQTPWVIPPRTFQRRAELENVSEFVCESTVDYQRLFKR* |
| Ga0079218_100345784 | 3300007004 | Agricultural Soil | VERFKLLPDGNLQYDVTVADPNVWQTPWTIPPRTFQRRPEENVAEFVCESTVDYQRLYKK |
| Ga0066710_1048784261 | 3300009012 | Grasslands Soil | KRLENGSLQYDLTVEDPNVFESPWVMPTRTFALRPELETVEEIVCESNVDYNKLFKKD |
| Ga0111539_105336771 | 3300009094 | Populus Rhizosphere | KLENGNLQYDVTVEDPNVWQTPWVIPARTFAFRPEFETVSEFVCESTVDYQRLFKK* |
| Ga0075418_110430103 | 3300009100 | Populus Rhizosphere | ENGNLQYEVTVEDPNVWVSPWAIPARTFTLRPETEWVSEFVCDAPPVDYKKLFGKD* |
| Ga0111538_107448591 | 3300009156 | Populus Rhizosphere | QYDVTVEDPNVWQAPWVIPARTFQRRSELENVAEFVCESTVDYQRLFKK* |
| Ga0075423_127701551 | 3300009162 | Populus Rhizosphere | FKRLENGNLQYDVTVEDPNVWVSPWVIPTRTFTRRPEADWVEEFVCESNIDYNRLFKKEDAK* |
| Ga0105248_111747241 | 3300009177 | Switchgrass Rhizosphere | TVEDPNVWVRPWVIPARTFPLRPEAEYVSEFVCDAPVVDYQKLFGK* |
| Ga0105347_11782472 | 3300009609 | Soil | ERFRKLENGSLQYEVTVDDPNVWEQPWAIAPRTFPLRPELEFVAEFVCESTVDYQRLFKK |
| Ga0126310_112037602 | 3300010044 | Serpentine Soil | GSLQYDVTVEDPNVWQAPWVIPARTFARRTELDNVAEFVCESTVDYNRLFKKE* |
| Ga0126373_111137681 | 3300010048 | Tropical Forest Soil | TVEDPNVWTGAWVIPTRTFAYRPEEEWVDEFVCDANVDYNKLFKKD* |
| Ga0126377_109541521 | 3300010362 | Tropical Forest Soil | KFKKLENGNLQYEVTVEDPNVWVSPWVIPPRTFQRQRQTEFVSEFVCDAPPIDYQKLFGKD* |
| Ga0126377_112119372 | 3300010362 | Tropical Forest Soil | VTVEDPNVWVSPWAIPARTFNLRRETEFVSEFVCDAPVIDYQKLFGK* |
| Ga0134121_116997632 | 3300010401 | Terrestrial Soil | LPYEVTVEDPNVWQTPWVIPARTFPRRPEVEFISEFVCEPRTDYQRLFKKD* |
| Ga0134123_101924642 | 3300010403 | Terrestrial Soil | DVTVDDPNVWEKPWVIPARTFALRPEIEFVSEFVCESTVDYQRLFKR* |
| Ga0137428_10885542 | 3300011432 | Soil | ENGSLQYDVTVEDPNVWETPWAIPARTFPFRPEIEFVSEFVCESTVDYSRLFKKE* |
| Ga0150985_1062784712 | 3300012212 | Avena Fatua Rhizosphere | EKFKKLENGNLQYEVTVEDPNVWVGPWAIPARTFQHRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0150985_1114539983 | 3300012212 | Avena Fatua Rhizosphere | VEDPNVWQTPWKIAARTFPRRPELENVSEFVCESTVDYQRLFKQ* |
| Ga0137368_106194542 | 3300012358 | Vadose Zone Soil | YDVTVEDPNLWQTPWVIPARTFPRRPEVEFISEFVCEPRTDYQRLFKKE* |
| Ga0150984_1100765371 | 3300012469 | Avena Fatua Rhizosphere | LENGNLQYEVTVEDPNVWVSPWAIPARTFQHRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0150984_1154142691 | 3300012469 | Avena Fatua Rhizosphere | GNLQYDVTVEDPNVWAGPWVIPARTFTYKPEAEWVEEFICDANVDYNKLFKKE* |
| Ga0150984_1177630811 | 3300012469 | Avena Fatua Rhizosphere | PDGNLQYEVTVEDPNVWQNPWKIAARTFPRRQELENVSEFVCESTVDYQRLFKQ* |
| Ga0157332_10756392 | 3300012511 | Soil | RKLENGNLQYDVTVEAPNVWETPWAIPARTFAFRPEFAFVSEFVCESTVDYQRLFKK* |
| Ga0137373_105961782 | 3300012532 | Vadose Zone Soil | RFRRLENGNLQYDVTVEDPNLWQTPWVIPARTFPRRPEVEFISEFVCEPRTDYQRLFKKE |
| Ga0157299_101015522 | 3300012899 | Soil | GNLQYSVTVEDPNVWQDPWVIPPRTFQRRPELENVAEFVCESTVDYQRLFKK* |
| Ga0157296_100318971 | 3300012905 | Soil | VTVDDPNVWEQPWAIAPRTFPLRPELEFVAEFVCESTVDYQRLFKK* |
| Ga0157297_100272753 | 3300012914 | Soil | YEVTVDDPNVWEQPWAIAPRTFPLRPELEFVAEFVCESTVDYQRLFKK* |
| Ga0126369_105892903 | 3300012971 | Tropical Forest Soil | YDVTVEDPNVWVSSWVIPTRTFTRRPEADWVEEFVCESNIDYNRLFKKEDGK* |
| Ga0157374_112191742 | 3300013296 | Miscanthus Rhizosphere | AVNEKFKKRDNGNLQYGVTVEDPNVGVRPWAIPARTFQHRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0157375_107256701 | 3300013308 | Miscanthus Rhizosphere | VTVEDPNVWVRPWAIPARTFQRRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0157375_113557151 | 3300013308 | Miscanthus Rhizosphere | KLDNGNLQYEVTVEDPNVWVRPWAIPARTFQHRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0157375_114586881 | 3300013308 | Miscanthus Rhizosphere | VTVEDPNVWQTPWVIPARTFQRRQELENVAEFVCESTVDYQRLFKK* |
| Ga0157375_130450641 | 3300013308 | Miscanthus Rhizosphere | NGSLQYEVTVEDPNVWVRPWVIPARTFPLRPEAEYVSEFVCDAPVVDYQKLFGKDKD* |
| Ga0075327_12400562 | 3300014272 | Natural And Restored Wetlands | LPDGSLQYDVTVEDPNVWQTPWVIPARTFRFRPELEFVSEFVCESTVDYTRLFKKD* |
| Ga0157377_113433881 | 3300014745 | Miscanthus Rhizosphere | VTVEDPNVWQTPWLIPARTFQRRQALENVAEFVCESTVDYQRLF* |
| Ga0157376_100836881 | 3300014969 | Miscanthus Rhizosphere | RLQPDGNLQYEVTVEDPNVWQNPWKIAPRTFQRRPELDNVAEFVCESTVDYQRLFKQ* |
| Ga0173478_102953212 | 3300015201 | Soil | LLPDGNLQYDVTVEDPNVWQTPWLIPARTFQRRQELENVAEFVCESTVDYQRLFKK* |
| Ga0137409_115105242 | 3300015245 | Vadose Zone Soil | TVEDPNVWVRPWAIPARTFQHRPETEYVSEFVCDAPVVDYQKLFGK* |
| Ga0132256_1001046951 | 3300015372 | Arabidopsis Rhizosphere | RKLENGNLQYDVTVEDPNVWQTPWVIPARTFAFRPEFETVSEFVCESTVDYQRLFKK* |
| Ga0132257_1017641841 | 3300015373 | Arabidopsis Rhizosphere | TVEDPNVWQTPWVIPPRTFQRRAELENVSEFVCESTVDYQRLFKK* |
| Ga0132255_1037323842 | 3300015374 | Arabidopsis Rhizosphere | VIEKFKKLENGNLQYEVTVEDPNVWVAPWAIPARTFQRQAQAEFVSEFVCDAPAVDYQKLFGKD* |
| Ga0182035_111802321 | 3300016341 | Soil | RFKRLENGNLQYDVTVEDPNVWMGPWIIPTRTFTYRPESEWVEEFVCDANVDYNKLFKKD |
| Ga0184627_101946273 | 3300018079 | Groundwater Sediment | GSLQYDVTVEDSNVWEKPWVIPTRTFALRPELEYVSEFVCESTVD |
| Ga0066655_114250571 | 3300018431 | Grasslands Soil | NGNLQYDVTVEDPNLWQTPWVIPARTFPRRPEVEFISEFVCEPRTDYQRLFKKE |
| Ga0190275_120754751 | 3300018432 | Soil | TVEDPNVWEKPWVIPPRTFALRPEMEFVSEFVCESTVDYGKLFK |
| Ga0190270_105288931 | 3300018469 | Soil | ERFRLLPDGNLQYGVMVDDPNVWQDPWVIPPRTFQRRPELENVAEFVCESSVDYQRLFKK |
| Ga0190264_109801062 | 3300019377 | Soil | EDPNVWEGPWVIPARTFPLRPEVEFVSEFVCESTVDYGRLFKK |
| Ga0247746_11747101 | 3300022886 | Soil | RKLENGSLQYEVTVDDPNVWEQPWAIAPRTFPLRPELEFVAEFVCESTVDYQRLFKK |
| Ga0247784_10790821 | 3300023270 | Plant Litter | FKKLENGNLQYDVTVQDPNVWVSPWVIPARTFQLRPEAEYVSEFVCDAPAVDYQKLFGKP |
| Ga0207680_101901671 | 3300025903 | Switchgrass Rhizosphere | EVTVEDPNVWTTPWVIPARTFAGRPELDSVAEFVCESRVDYSKMFKK |
| Ga0207701_113602752 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LQYDVTVEDPNVWETPWVIPARTFPFRPELEFVSEFVCESTVDYQRLFKKN |
| Ga0207644_110292271 | 3300025931 | Switchgrass Rhizosphere | RFKTLDNGSLQYEVTVEDPNVWVKPWVIPARTFPLRKETEFVSEFVCDAPVVDYQKLFGN |
| Ga0207704_110981801 | 3300025938 | Miscanthus Rhizosphere | KKLENGSLQYEVTVEDPNVWVRPWVIPARTFALRAETEYVSEFVCDAPVVDYQKLFEKK |
| Ga0207679_119188332 | 3300025945 | Corn Rhizosphere | QYEVTVEDPNVWQNPWKIAARTFPRRQELENVSEFVCESTVDYQRLFKQ |
| Ga0207658_119877361 | 3300025986 | Switchgrass Rhizosphere | SLQYEVTVDDPNVWEQPWAIAPRTFPLRPELEFVAEFVCESTVDYQRLFKK |
| Ga0207641_116860613 | 3300026088 | Switchgrass Rhizosphere | EDPNVWQNPWKIAARTFPRRPELENVSEFVCESTVDYQRLFKR |
| Ga0209387_10840021 | 3300027639 | Agricultural Soil | VADPNAWQTPWTIPPRTFQRRPEENVAEFVCESTVDYQRLYKK |
| Ga0209485_11627032 | 3300027691 | Agricultural Soil | RFRRLDNGSLQYDVTVEDPNVWEKPWVIPSRTFAFRPELEFVSEFVCESSVDYNRLFKKD |
| Ga0207428_104491081 | 3300027907 | Populus Rhizosphere | RFRKLENGSLQYEVTVEDPNVWEQPWAIPPRTFPLRPELEFVAEFVCESTVDYQRLFKK |
| Ga0209382_109227702 | 3300027909 | Populus Rhizosphere | ELQYDVTVEDPNVWEKPWVIPARTFPYRPELEFVSEFVCESTVDYQRLFKK |
| Ga0247819_102692991 | 3300028608 | Soil | LQYGVTVEDPNVWQTPWVIPVRTFTRRAELENVSEFVCESRVDYQRLFKK |
| Ga0307503_106767742 | 3300028802 | Soil | LQYDVTVEDPNVWQTPWVIPARTFPRRAELENVSEFVCESTVDYQRLFKR |
| Ga0170824_1245294441 | 3300031231 | Forest Soil | GNLQYEVTVEDPNVWVSPWAIPARTFQHRPETEYVSEFVCDAPVVDYQKLFGK |
| Ga0265342_106665601 | 3300031712 | Rhizosphere | IERYRRLENGSLQYDVTVEDPNVWGSPWVMPQRTFAFRPDLETVDEFVCESNPDYGKLFKKD |
| Ga0307413_117588621 | 3300031824 | Rhizosphere | DPNVWDGPWKIAPRTFAYRPEIEFVSEFVCESRVDYSRLFKQ |
| Ga0310907_105118712 | 3300031847 | Soil | VEDPNVWQTPWVIPVRTFTRRAELENVSEFVCESRVDYQRLFKK |
| Ga0310912_106141353 | 3300031941 | Soil | QYDVMVEDPNVWTGPWVIPTRTFTYRPEAEWVEEFVCDATVDYNKLFKKE |
| Ga0310885_108913721 | 3300031943 | Soil | SLQYDVTVEDPNVWETPWVIPPRTFPFRPELEFVSEFVCESTVDYQRLFKKN |
| Ga0310884_106990881 | 3300031944 | Soil | ENGNLQYDVTVEDPNVWAAPWVIPSRTFTHRPEAEWVDEFVCDAPPVDYQKLLGKD |
| Ga0310909_101643671 | 3300031947 | Soil | NLQYDVMVEDPNVWTGPWVIPTRTFTYRPEAEWVEEFVCDATVDYNKLFKKE |
| Ga0307414_101599223 | 3300032004 | Rhizosphere | LLPDGNLQYDVTVEDPNVWQTPWAIPSRTFQRRPEENVAEFVCESSVDYQRLYKK |
| Ga0307411_122400981 | 3300032005 | Rhizosphere | VTVEDPNVWDGPWKIAPRTFAYRPEIEFVSEFVCESRVDYSRLFKQ |
| Ga0310902_103243151 | 3300032012 | Soil | DGNLQYEVTVEDPNVWQTPWAIPMRTFQRRPEENVAEFVCESRVDYQRLFKK |
| Ga0306924_108558441 | 3300032076 | Soil | GNLQYDVMVEDPNVWTGPWVIPTRTFTYRPEAEWVEEFVCDATVDYNKLFKKE |
| Ga0307471_1012501621 | 3300032180 | Hardwood Forest Soil | EVTVEDPNVWASPWAIPARTFQVRPEAEFVSEFVCDAPAVDYQKLFGKD |
| Ga0310810_104194961 | 3300033412 | Soil | SLQYDVTVEDPNVWQTAWVIPTRTFARRAELENVSEFVCESTVDYSKLFKKAQ |
| Ga0314781_040564_3_185 | 3300034660 | Soil | RFRRLENGSLQYDVTVEDPNVWETPWVIPPRTFPFRPELEFVSEFVCESTVDYQRLFKKN |
| ⦗Top⦘ |