Basic Information | |
---|---|
Family ID | F087939 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 47 residues |
Representative Sequence | DVAASPVPTAKGHADSLDRPGLGIDVDEDRVRQHRVAIATRNVA |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.82 % |
% of genes near scaffold ends (potentially truncated) | 98.18 % |
% of genes from short scaffolds (< 2000 bps) | 90.91 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.636 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (8.182 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 0.00% Coil/Unstructured: 87.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 7.27 |
PF03797 | Autotransporter | 6.36 |
PF13531 | SBP_bac_11 | 4.55 |
PF11937 | DUF3455 | 3.64 |
PF00496 | SBP_bac_5 | 2.73 |
PF10518 | TAT_signal | 2.73 |
PF12833 | HTH_18 | 1.82 |
PF13683 | rve_3 | 1.82 |
PF06035 | Peptidase_C93 | 1.82 |
PF13379 | NMT1_2 | 1.82 |
PF05853 | BKACE | 0.91 |
PF00015 | MCPsignal | 0.91 |
PF02894 | GFO_IDH_MocA_C | 0.91 |
PF14525 | AraC_binding_2 | 0.91 |
PF08240 | ADH_N | 0.91 |
PF02738 | MoCoBD_1 | 0.91 |
PF02518 | HATPase_c | 0.91 |
PF03775 | MinC_C | 0.91 |
PF08448 | PAS_4 | 0.91 |
PF00528 | BPD_transp_1 | 0.91 |
PF03992 | ABM | 0.91 |
PF01717 | Meth_synt_2 | 0.91 |
PF00392 | GntR | 0.91 |
PF13578 | Methyltransf_24 | 0.91 |
PF17167 | Glyco_hydro_36 | 0.91 |
PF13085 | Fer2_3 | 0.91 |
PF03401 | TctC | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.82 |
COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.91 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.91 |
COG0850 | Septum site-determining protein MinC | Cell cycle control, cell division, chromosome partitioning [D] | 0.91 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.91 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.64 % |
Unclassified | root | N/A | 16.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2209111006|2214567195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
3300001398|JGI20207J14881_1060728 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300002077|JGI24744J21845_10009989 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300003990|Ga0055455_10201235 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300004062|Ga0055500_10147990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
3300004480|Ga0062592_101020633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga rosea | 758 | Open in IMG/M |
3300004480|Ga0062592_102633512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Jannaschia → unclassified Jannaschia → Jannaschia sp. | 508 | Open in IMG/M |
3300005295|Ga0065707_10478162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
3300005334|Ga0068869_101084534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
3300005335|Ga0070666_10057875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2620 | Open in IMG/M |
3300005335|Ga0070666_11381540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
3300005344|Ga0070661_100526282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 949 | Open in IMG/M |
3300005355|Ga0070671_100020200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5428 | Open in IMG/M |
3300005542|Ga0070732_10259923 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300005546|Ga0070696_101132983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
3300005546|Ga0070696_101397218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Jannaschia → unclassified Jannaschia → Jannaschia sp. | 597 | Open in IMG/M |
3300005614|Ga0068856_100443634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1318 | Open in IMG/M |
3300005614|Ga0068856_100909513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 899 | Open in IMG/M |
3300005764|Ga0066903_104039725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 786 | Open in IMG/M |
3300005983|Ga0081540_1057416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1882 | Open in IMG/M |
3300006028|Ga0070717_10842752 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300006042|Ga0075368_10541638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 522 | Open in IMG/M |
3300006052|Ga0075029_101260822 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006237|Ga0097621_102057930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
3300006579|Ga0074054_11785075 | Not Available | 665 | Open in IMG/M |
3300006638|Ga0075522_10392809 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300006845|Ga0075421_102704197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300006871|Ga0075434_102009231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 583 | Open in IMG/M |
3300009101|Ga0105247_10588029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 824 | Open in IMG/M |
3300009101|Ga0105247_10783800 | Not Available | 726 | Open in IMG/M |
3300009167|Ga0113563_11671158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
3300009662|Ga0105856_1102305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium | 837 | Open in IMG/M |
3300009762|Ga0116130_1058593 | Not Available | 1214 | Open in IMG/M |
3300010046|Ga0126384_10331468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1262 | Open in IMG/M |
3300010359|Ga0126376_12743232 | Not Available | 542 | Open in IMG/M |
3300010361|Ga0126378_12009845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
3300010376|Ga0126381_100964136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1229 | Open in IMG/M |
3300010396|Ga0134126_12169965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 606 | Open in IMG/M |
3300010398|Ga0126383_10773976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1042 | Open in IMG/M |
3300010401|Ga0134121_10816946 | Not Available | 897 | Open in IMG/M |
3300011427|Ga0137448_1057540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
3300011442|Ga0137437_1118242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
3300011444|Ga0137463_1116230 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300012363|Ga0137390_10477691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1221 | Open in IMG/M |
3300012363|Ga0137390_11218462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
3300012891|Ga0157305_10001825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2512 | Open in IMG/M |
3300012948|Ga0126375_10416887 | Not Available | 976 | Open in IMG/M |
3300012964|Ga0153916_11532159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
3300012986|Ga0164304_10395922 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300012987|Ga0164307_11486990 | Not Available | 572 | Open in IMG/M |
3300012988|Ga0164306_10678396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
3300013104|Ga0157370_10583448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
3300014321|Ga0075353_1242193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
3300014325|Ga0163163_10434485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1372 | Open in IMG/M |
3300014838|Ga0182030_11272520 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300015077|Ga0173483_10277317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 810 | Open in IMG/M |
3300015164|Ga0167652_1090086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense | 503 | Open in IMG/M |
3300015190|Ga0167651_1079223 | Not Available | 651 | Open in IMG/M |
3300015203|Ga0167650_1017921 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
3300015372|Ga0132256_100218442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 1961 | Open in IMG/M |
3300015373|Ga0132257_103933165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 540 | Open in IMG/M |
3300017936|Ga0187821_10199996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
3300017936|Ga0187821_10434909 | Not Available | 542 | Open in IMG/M |
3300017973|Ga0187780_10213353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1347 | Open in IMG/M |
3300018058|Ga0187766_10845158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 642 | Open in IMG/M |
3300018070|Ga0184631_10278639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
3300021560|Ga0126371_11223548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 887 | Open in IMG/M |
3300022553|Ga0212124_10365883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 760 | Open in IMG/M |
3300023067|Ga0247743_1006823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
3300024056|Ga0124853_1275428 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
3300025326|Ga0209342_10466328 | Not Available | 1058 | Open in IMG/M |
3300025457|Ga0208850_1023548 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300025464|Ga0208076_1074705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300025527|Ga0208714_1007232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2961 | Open in IMG/M |
3300025560|Ga0210108_1126812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
3300025725|Ga0209638_1013250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4211 | Open in IMG/M |
3300025817|Ga0210144_1042050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
3300025829|Ga0209484_10051215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 900 | Open in IMG/M |
3300025862|Ga0209483_1307643 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300025888|Ga0209540_10238991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1059 | Open in IMG/M |
3300025900|Ga0207710_10558005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 597 | Open in IMG/M |
3300025900|Ga0207710_10579398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
3300025900|Ga0207710_10710165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
3300025931|Ga0207644_10023544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4220 | Open in IMG/M |
3300025942|Ga0207689_11610388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 540 | Open in IMG/M |
3300026048|Ga0208915_1031984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
3300026053|Ga0208422_1032664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
3300026273|Ga0209881_1157284 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026344|Ga0256800_1005947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 657 | Open in IMG/M |
3300026717|Ga0207526_101413 | Not Available | 714 | Open in IMG/M |
3300027000|Ga0207803_1005042 | Not Available | 2015 | Open in IMG/M |
3300027517|Ga0209113_1014706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1006 | Open in IMG/M |
3300027854|Ga0209517_10268839 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300028381|Ga0268264_10688071 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300029907|Ga0311329_10762245 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300031152|Ga0307501_10209405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 562 | Open in IMG/M |
3300031232|Ga0302323_101424277 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300031724|Ga0318500_10046425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1825 | Open in IMG/M |
3300031847|Ga0310907_10170246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1017 | Open in IMG/M |
3300032003|Ga0310897_10002861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4576 | Open in IMG/M |
3300032017|Ga0310899_10215502 | Not Available | 857 | Open in IMG/M |
3300032075|Ga0310890_10118115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1698 | Open in IMG/M |
3300032722|Ga0316231_1061629 | Not Available | 1983 | Open in IMG/M |
3300032782|Ga0335082_11001910 | Not Available | 700 | Open in IMG/M |
3300032782|Ga0335082_11444039 | Not Available | 559 | Open in IMG/M |
3300032783|Ga0335079_11245610 | Not Available | 746 | Open in IMG/M |
3300033158|Ga0335077_11935774 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300033475|Ga0310811_10015390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10001 | Open in IMG/M |
3300033513|Ga0316628_103519224 | Not Available | 565 | Open in IMG/M |
3300034195|Ga0370501_0308390 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 8.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.55% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.64% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.73% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.82% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.91% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.91% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.91% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.91% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.91% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.91% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.91% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026048 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
3300026344 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 C5 | Environmental | Open in IMG/M |
3300026717 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A2-12 (SPAdes) | Environmental | Open in IMG/M |
3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2213611604 | 2209111006 | Arabidopsis Rhizosphere | DVAASPVPTAKGHADSLDRPGLGIDVDEDRVRQHRVAIATRNVA |
JGI20207J14881_10607282 | 3300001398 | Arctic Peat Soil | IPNIHWALTMTHTALAADVTATPVPTARGHADSLDRPGLGVEVDMDCVNRHRVHIAVRDVA* |
JGI24744J21845_100099891 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | DIAKSPLPTGKGFAESLDRPGLGIEVDEDRVSRHRVQIAARSVA* |
Ga0055455_102012352 | 3300003990 | Natural And Restored Wetlands | TAQPLPTAQGHADVLDRPGLGVEVDEERVRAHRVAIEVRELA* |
Ga0055500_101479902 | 3300004062 | Natural And Restored Wetlands | TGLAEDVAVSPIPTAKGHVDSLDRPGLGVDVDEAQIRRHRVAIATRNVA* |
Ga0062592_1010206332 | 3300004480 | Soil | EDVARSPLPTGKGFAETLDRPGLGIEVDEDRVRRHRVQIATRSVA* |
Ga0062592_1026335121 | 3300004480 | Soil | LTHFGLAEDVAVSAIPAAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA* |
Ga0065707_104781622 | 3300005295 | Switchgrass Rhizosphere | FGLAEDVAVSAIPTAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA* |
Ga0068869_1010845341 | 3300005334 | Miscanthus Rhizosphere | NIGWALTLTHFGLAEDVAVSAIPTAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA* |
Ga0070666_100578751 | 3300005335 | Switchgrass Rhizosphere | SPVPTAKGHADSLDRPGLGIDVDEDCVRQHRVAIATRNVA* |
Ga0070666_113815401 | 3300005335 | Switchgrass Rhizosphere | SLPTGKGFAESLDRPGLGVDVDEDRVRRHRVQITARSVA* |
Ga0070661_1005262821 | 3300005344 | Corn Rhizosphere | THLGLAEDVAKSSLPTGKGFAESLDRPGLGVDVDEDRIRRHRVQITARSVA* |
Ga0070671_1000202001 | 3300005355 | Switchgrass Rhizosphere | HTGIADDVVTQPIPTARGHVDSLDRPGLGVDVDEDAVRRYRVTIAARNVA* |
Ga0070732_102599231 | 3300005542 | Surface Soil | ACVIPNIAWGLTLTHLALAEDVTAQPLATARGHAESIDRPGLGINVDEDRVRAHRVAIAARNVA* |
Ga0070696_1011329833 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GLAEDVAASPVPTAKGHADSLDRPGLGIDVDEDRVRQHRVAIATRNVA* |
Ga0070696_1013972181 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | WALTLTHFGLAEDVAVSAIPAAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA* |
Ga0068856_1004436343 | 3300005614 | Corn Rhizosphere | IPTARGHVESLERPGLGVDVDEDLVRRHRVEVTAREFA* |
Ga0068856_1009095133 | 3300005614 | Corn Rhizosphere | GKGFAESLDRPGLGVDVDEDRIRRHRVQITARSVA* |
Ga0066903_1040397251 | 3300005764 | Tropical Forest Soil | EDVAVHPVPTGKGHAESLDRPGLGIDVDEDRVRRHRVPIAGRNVA* |
Ga0081540_10574161 | 3300005983 | Tabebuia Heterophylla Rhizosphere | HTGLAEDISAAPIPTANGHVQVLERPGLGVDVDENRVRGHAVAISARNIA* |
Ga0070717_108427521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GIADDIVTQPIPTAKGHVNSLDQPGLGIDVDEDLVRRHRVMIAARDVA* |
Ga0075368_105416381 | 3300006042 | Populus Endosphere | DVAKSSLPTGKGFAESLDRPGLGVDVDEDRIRRHRVQITARSVA* |
Ga0075029_1012608222 | 3300006052 | Watersheds | AWALTLTHIALAEDVTAQPIQTARGHVDSIDRPGLGIDVDENSVRRHRVQIASRAVA* |
Ga0097621_1020579301 | 3300006237 | Miscanthus Rhizosphere | LPTGKGFAESLDRPGLGVDVDEDRVRRHRVQITARSVA* |
Ga0074054_117850752 | 3300006579 | Soil | HLGLAEDIAKSPLPTGKGFADSLDRPGIGIEVDEDRVRRHRVQIAARSVA* |
Ga0075522_103928092 | 3300006638 | Arctic Peat Soil | TAQPLATARGHVEALDRPGLGIDVDDEHVRRHRVAIPSRNVA* |
Ga0075421_1027041971 | 3300006845 | Populus Rhizosphere | GELTEDVTAQPIRIHQGHADILERPGLGIDVDEDRVRRYRVGSPSRYVA* |
Ga0075434_1020092312 | 3300006871 | Populus Rhizosphere | KGHADSLDRPGLGIDVDEDCVRQHRVAIATRNVA* |
Ga0105247_105880293 | 3300009101 | Switchgrass Rhizosphere | AASPVPTAKGHADSLDRPGLGIDVDEDRVRQHRVAIATRNVA* |
Ga0105247_107838003 | 3300009101 | Switchgrass Rhizosphere | VPTAKGHADNLDHPGLGIDVDEDRVRQHRVAIATRNVA* |
Ga0113563_116711581 | 3300009167 | Freshwater Wetlands | VTAQPVPTGKGYADSLDRPGLGIDIDEDRVRHHRVQIATRNVA* |
Ga0105856_11023052 | 3300009662 | Permafrost Soil | KGFAESLDRPGLGIDVDEDRVRRHRVPIAARSTV* |
Ga0116130_10585932 | 3300009762 | Peatland | LAEDVTAQPIRTARGHVDAIDRPGLGIDVDEDRVRRHRVAIPTRNVA* |
Ga0126384_103314681 | 3300010046 | Tropical Forest Soil | GLAEDVARSPLPTGKGHAESLDRPGLGVDVDEDRVSRHRVQIAARSVA* |
Ga0126376_127432321 | 3300010359 | Tropical Forest Soil | VPTARGHVEVDSLDGPGLGIDVDEDRVHRYRVVIGTHNVA* |
Ga0126378_120098452 | 3300010361 | Tropical Forest Soil | AAALHAASVVPNIKWGLTLTHTGLADDVVTLPVPTAKGHVESLERSGLGINVDEDRIRGYRVHIAAKNIA* |
Ga0126381_1009641363 | 3300010376 | Tropical Forest Soil | AVHPVPTGKGHAESLDRPGLGIDVDEDRVRRHRVPIAGRNVA* |
Ga0134126_121699652 | 3300010396 | Terrestrial Soil | LTLTHTSLAEDVTAQPIATLRGHAERIERPGLGIDVDEDRVRRHRVQIATRNVA* |
Ga0126383_107739762 | 3300010398 | Tropical Forest Soil | VAVHPVPAGKGHAESLDRPGLGIDVDEDRVRRHRVPIASRNVA* |
Ga0134121_108169462 | 3300010401 | Terrestrial Soil | LTHTGIADDIVTQPIPTAKGHVNSRDQPGLGIDVDEDLVRRHRVMIAARDVA* |
Ga0137448_10575402 | 3300011427 | Soil | IPNIAWGLTLTHTSLGEDVTAQPVPTGQGFADSLDRPGLGVDVDEDRVRRHPVQIAARNVA* |
Ga0137437_11182421 | 3300011442 | Soil | EDVTAQPVPTGQGHADSLDRPGLGVDVDEDRVRRHRVQIAARNVA* |
Ga0137463_11162301 | 3300011444 | Soil | TGLAEDVVASPLATAKGHVQGLDRPGLGVDVDEDRVRRHRVAIATRNVV* |
Ga0137390_104776911 | 3300012363 | Vadose Zone Soil | VASVIPNIAWGLTLTHTGLAEDVAVSPVPTAKGHVDSLERPGLGVDIDENRVRRHRVAIAARNVA* |
Ga0137390_112184621 | 3300012363 | Vadose Zone Soil | AWGLTLTHTGLAEDVVVSPLPTAKGHVEDLDQPGLGVDVDENRVRCHRVAIATRNVAR* |
Ga0157305_100018251 | 3300012891 | Soil | KSPLPTGKGFAESLDRPGLGIEVDEDRVSRHRVQIAARSVA* |
Ga0126375_104168871 | 3300012948 | Tropical Forest Soil | VLPNIDWGLTLTHTGLAEDISAWPIPIVIGHVDVLERPGLGVDTDEDRVRRHRIAIGTRNVA* |
Ga0153916_115321591 | 3300012964 | Freshwater Wetlands | LGEDVTAQPIRTAQGHVESLDRPGLGVDVDEDRVRRHRVQIATRNVA* |
Ga0164304_103959221 | 3300012986 | Soil | EDVAASPVPTAKGHADSLDRPGLGIDVDEDCVRQHRVAIATRNVA* |
Ga0164307_114869902 | 3300012987 | Soil | TAQPIPTAKGHVDGLDRPGLGVDVDDDRIRRHRVAMAARNVA* |
Ga0164306_106783961 | 3300012988 | Soil | QPIPTARGHVESLERPGLGVDVDEDLVRRHRVEVTAREFA* |
Ga0157370_105834482 | 3300013104 | Corn Rhizosphere | AWALTLTHTGLAADVTAQPIPTARGHVESLERPGLGVDVDEDLVRRHRVEVTAREFA* |
Ga0075353_12421931 | 3300014321 | Natural And Restored Wetlands | TLTHVGLAEDIAKSPLPTGKGFVESLDRPGLGIEVDEDRVRRHRVQIAAQSVA* |
Ga0163163_104344852 | 3300014325 | Switchgrass Rhizosphere | TGIADDVVTQPIPTAGGHVDSLDRPGLGVDVDEDVVRRYRVTIAVRNVA* |
Ga0182030_112725201 | 3300014838 | Bog | LATGKGYAESIDRPGLGIDVDEDRVRRHRVPIAGRDLA* |
Ga0173483_102773171 | 3300015077 | Soil | IGWALTLTHFGLAEDVAVSAIPAAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA* |
Ga0167652_10900862 | 3300015164 | Glacier Forefield Soil | DVTGHPVPTAHGQVECLDRPGLGVEVDEDRVRHHRVQIGS* |
Ga0167651_10792232 | 3300015190 | Glacier Forefield Soil | ALGEDVTAHPIATGHGHVDGLDRPGLGIGVDEDRVRRHRVAIATRNVA* |
Ga0167650_10179212 | 3300015203 | Glacier Forefield Soil | ITAQPIPTGQGHVETLDRPGLGVDVDEDRVRRHRVQIAPRNVA* |
Ga0132256_1002184423 | 3300015372 | Arabidopsis Rhizosphere | THTGIADDVVTQPIPTARGHVDSLDRPGLGVDVDEDVVRRYRVGIAARNVA* |
Ga0132257_1039331651 | 3300015373 | Arabidopsis Rhizosphere | AIPTAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA* |
Ga0187821_101999961 | 3300017936 | Freshwater Sediment | LTHSGLAEDVTAQPIRADRGHADSIERPGLGIEVDEDCVQRHRVPIAARHVA |
Ga0187821_104349091 | 3300017936 | Freshwater Sediment | THIGLAEDVTAQPVRNARGHVEGIDRPGLGIDVDEDRVQRHRVQIAARNVA |
Ga0187780_102133531 | 3300017973 | Tropical Peatland | GLTLTHTGLAEDVTAQPIPTARGHVDSLDRPGLGIDVDEDRVRRHRVTIAARNVA |
Ga0187766_108451582 | 3300018058 | Tropical Peatland | GLTLTHTGLAEDVAISPLPTAKGHVDGLDRPGLGVDVDEECVRRHQVLGRE |
Ga0184631_102786392 | 3300018070 | Groundwater Sediment | TAQPVPTANGHVDCLNRPGLGVEVDEDRVRRHRVPIATRNVA |
Ga0126371_112235482 | 3300021560 | Tropical Forest Soil | PVPTGKGHAESLDRPGLGIDVDEDRVRRHRVPIASRNVA |
Ga0212124_103658832 | 3300022553 | Freshwater | VIPNIAWGLTLTHTALDEDITAQPIQTAKGHVESLERPGLGVDIDEDRVRRHRVQIATRNVA |
Ga0247743_10068231 | 3300023067 | Soil | PTGKGFAESLDRPGLGIEVDEDRVSRHRVQIAARSVA |
Ga0124853_12754284 | 3300024056 | Freshwater Wetlands | VTAQPLPTANGHVASLDRPGLGVDVDEDRVRQHRVHIAARNVA |
Ga0209342_104663282 | 3300025326 | Soil | TAQPVPTANGNVDCLDRPGLGVEIDENRVRRHRVQIATRNVA |
Ga0208850_10235481 | 3300025457 | Arctic Peat Soil | PIRTDKGHADSIDRPGLGIEVDEDRVRRHRVQIATRNVA |
Ga0208076_10747051 | 3300025464 | Arctic Peat Soil | QPIPTARGHVDGFDRPGLGVDVDDDLVRRHRVPIATRNVA |
Ga0208714_10072323 | 3300025527 | Arctic Peat Soil | EDVTAQPLATARGHAEALDRPGLGIDVDDEHVRRRRVAIPTRNVA |
Ga0210108_11268122 | 3300025560 | Natural And Restored Wetlands | EDVATSPLPTGKGFAESLDRPGLGIEVDEDRVRRHRVQIAARASPRHVA |
Ga0209638_10132505 | 3300025725 | Arctic Peat Soil | MIRQSLTHTGLAQDVTAQPIAIVQGHVESLDRPGLGIDVDEDRVRRHRVPVATRNMA |
Ga0210144_10420501 | 3300025817 | Natural And Restored Wetlands | PVPTAKGHVARLDRPGLGIEVDEERVQRHRVPIAAREVA |
Ga0209484_100512151 | 3300025829 | Arctic Peat Soil | GEDVTAQPIPTARGHVESLDRPGLGIDVDEDRVRRHRVPIATRSLA |
Ga0209483_13076431 | 3300025862 | Arctic Peat Soil | TAQPLATARGHVEALDRPGLGIDVDDEHVRRHRVAIPSRNVA |
Ga0209540_102389913 | 3300025888 | Arctic Peat Soil | ARGQVESLDRPGLGIDVDEDRVRRHRVPIVMRNMA |
Ga0207710_105580051 | 3300025900 | Switchgrass Rhizosphere | ASPVPTAKGHADSLDRPGLGIDVDEDRVRQHRVAIATRNVA |
Ga0207710_105793982 | 3300025900 | Switchgrass Rhizosphere | HTGLAEDVAASPVPTAKGHADSLDRPGLGIDVDEDCVRQHRVAIATRNVA |
Ga0207710_107101651 | 3300025900 | Switchgrass Rhizosphere | TGIADDVVTQPIPTARGHVDSLDRPGLGVDVDEDAVRRYRVTIAARNVA |
Ga0207644_100235449 | 3300025931 | Switchgrass Rhizosphere | HTGIADDVVTQPIPTARGHVDSLDRPGLGVDVDEDAVRRYRVTIAARNVA |
Ga0207689_116103881 | 3300025942 | Miscanthus Rhizosphere | PNIGWALTLTHFGLAEDVAVSAIPTAGGHVDILDRPGLGVDVDEDRVRHHRVAIATRNVA |
Ga0208915_10319841 | 3300026048 | Natural And Restored Wetlands | TLTHVGLAEDIAKSPLPTGKGFVESLDRPGLGIEVDEDRVRRHRVQIAAQSVA |
Ga0208422_10326642 | 3300026053 | Natural And Restored Wetlands | EDVATSPLPTGKGFAESLDRPGLGIEVDEDRVRRHRVQIAARSVA |
Ga0209881_11572841 | 3300026273 | Soil | PIPTGQGHVDTLDRPGLGVDVDEDRVRRHRVHIPARQVA |
Ga0256800_10059471 | 3300026344 | Sediment | IGLAEDVATQPLPTAKGHADSLDRPGLGIDVDENRVRRHRVGISTRNVA |
Ga0207526_1014131 | 3300026717 | Soil | GLAEDIAKSPLPTGKGFAESLDRPGLGIEVDEDRVSRHRVQIAARSVA |
Ga0207803_10050421 | 3300027000 | Tropical Forest Soil | LAEDVTAQPVPTANGHTACLDRPGLGVEVDEDRVRRHRVQIAARNVA |
Ga0209113_10147062 | 3300027517 | Forest Soil | LTLTHTALGEDVTGHPIPTARGHVEGLDRPGLGVVVDEDRVRRHRVQIAAREMA |
Ga0209517_102688393 | 3300027854 | Peatlands Soil | TLTHSGLAEDVTAQPILTDKDHADSIERPGLGIEVDEDRVRRHRVQIATRNVA |
Ga0268264_106880711 | 3300028381 | Switchgrass Rhizosphere | VAASPVPTAKGHADSLDRPGLGIDVDEDCVRQHRVAIATRNVA |
Ga0311329_107622452 | 3300029907 | Bog | IAWGLTLTHTSLGEDVTAQPLATGKGYAESLDRPGLGVDVDDDRVRRHRVHIAARDVA |
Ga0307501_102094052 | 3300031152 | Soil | DVTARPIVTARGHVEGLDGPGLGVDVDEDRVRRHRVRIAARNVA |
Ga0302323_1014242771 | 3300031232 | Fen | PIPTARGHVELIDRPGLGVDVDEDRVRRSRIGIAARAVR |
Ga0318500_100464251 | 3300031724 | Soil | TKGFVDSLDRPGLGVDVDEDAVRRHRVTIAARNVA |
Ga0310907_101702461 | 3300031847 | Soil | LTLTHFGLAEDVAVSAIPAAGGHVNILDRPGLGVDVDEDRVRHHRVAIATRNVA |
Ga0310897_100028611 | 3300032003 | Soil | LTHFGLAEDVAVSAIPAAGGHVNILDRPGLGVDVDEDRVRHHRVAIATRNVA |
Ga0310899_102155022 | 3300032017 | Soil | IAGDVVTRPIPTARGHVDSLDRPGLGVDVDEDVVRRYRVAIAARNVA |
Ga0310890_101181151 | 3300032075 | Soil | WALTLTHFGLAEDVAVSAIPAAGGHVNILDRPGLGVDVDEDRVRHHRVAIATRNVA |
Ga0316231_10616291 | 3300032722 | Freshwater | TAKPIPTANGHVELVDRPGLGVDVDEDRVRHHRIPITARSVA |
Ga0335082_110019101 | 3300032782 | Soil | VVASPTPTAKGHADSLERPGLGVDVDENRVRRHRVAIATRNVA |
Ga0335082_114440392 | 3300032782 | Soil | PTARGHVEVLDRPGLGIEVDEARVHAHRVAIGVRDVA |
Ga0335079_112456101 | 3300032783 | Soil | TLTHTALAEDVTALPIETARGHVDRMDRPGLGIDVDEDRVRRHRVTIASRNVA |
Ga0335077_119357741 | 3300033158 | Soil | AEDVTAQPVATARGHVETLDRPGLGIEVDIDRVNRHRVDIASRAVA |
Ga0310811_100153901 | 3300033475 | Soil | IPTARGHVESLDRPGLGVIVDEDRVRRHRVPIATREMA |
Ga0316628_1035192242 | 3300033513 | Soil | LTLTHTALGEDVTARPIPTVRGHVESLDRPGLGVVVDEERVRHNRVPIAARNIA |
Ga0370501_0308390_446_571 | 3300034195 | Untreated Peat Soil | AKPLVTGKGFAESLDRLGLGIDVDEDRVRRHRVAIAARNVT |
⦗Top⦘ |