NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087937

Metagenome / Metatranscriptome Family F087937

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087937
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 47 residues
Representative Sequence MGEGSGLDVVAGRRLWRVSDRVVVLLRLGNASGGKGPDFWYAFEGAEDW
Number of Associated Samples 104
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.57 %
% of genes near scaffold ends (potentially truncated) 40.00 %
% of genes from short scaffolds (< 2000 bps) 87.27 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.455 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.636 % of family members)
Environment Ontology (ENVO) Unclassified
(19.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.455 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.16%    β-sheet: 0.00%    Coil/Unstructured: 55.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00078RVT_1 25.45
PF08388GIIM 8.18
PF13586DDE_Tnp_1_2 0.91
PF00106adh_short 0.91
PF07729FCD 0.91
PF13561adh_short_C2 0.91
PF13701DDE_Tnp_1_4 0.91
PF00665rve 0.91
PF01515PTA_PTB 0.91
PF02653BPD_transp_2 0.91
PF00903Glyoxalase 0.91
PF07929PRiA4_ORF3 0.91
PF02470MlaD 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0280Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase)Energy production and conversion [C] 0.91
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.91
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.91
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.91
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.91
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.91
COG4584TransposaseMobilome: prophages, transposons [X] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.45 %
UnclassifiedrootN/A4.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2081372006|FNTS_GKKEVUV02FY2JBAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei553Open in IMG/M
3300000095|LCrCPGB2aDRAFT_c053232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales707Open in IMG/M
3300001205|C688J13580_1017500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium844Open in IMG/M
3300001305|C688J14111_10020169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1962Open in IMG/M
3300001408|JGI20206J14855_1024486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium951Open in IMG/M
3300002568|C688J35102_117986349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei520Open in IMG/M
3300002568|C688J35102_120795365All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300004016|Ga0058689_10034784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei881Open in IMG/M
3300004082|Ga0062384_100743769All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300004091|Ga0062387_100730292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300004213|Ga0066648_10153392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1289Open in IMG/M
3300004479|Ga0062595_102649943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales504Open in IMG/M
3300004779|Ga0062380_10409437All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300004801|Ga0058860_12186511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei558Open in IMG/M
3300005337|Ga0070682_102034493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei506Open in IMG/M
3300005573|Ga0078972_1006807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales26453Open in IMG/M
3300005578|Ga0068854_101964383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei539Open in IMG/M
3300006237|Ga0097621_101793725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300006642|Ga0075521_10085126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1433Open in IMG/M
3300006893|Ga0073928_10335148All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300006903|Ga0075426_10902524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei666Open in IMG/M
3300006904|Ga0075424_101327461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales764Open in IMG/M
3300006954|Ga0079219_12037609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae547Open in IMG/M
3300007076|Ga0075435_102038686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300009038|Ga0099829_10162413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1790Open in IMG/M
3300009085|Ga0105103_10260174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales939Open in IMG/M
3300009488|Ga0114925_10030780All Organisms → cellular organisms → Bacteria → Proteobacteria3135Open in IMG/M
3300009500|Ga0116229_11569791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales519Open in IMG/M
3300009503|Ga0123519_10003380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales26438Open in IMG/M
3300009510|Ga0116230_10278973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1330Open in IMG/M
3300009638|Ga0116113_1104278All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300009701|Ga0116228_10740806All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300009709|Ga0116227_10075638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2842Open in IMG/M
3300010041|Ga0126312_10206693All Organisms → cellular organisms → Bacteria → Proteobacteria1373Open in IMG/M
3300010044|Ga0126310_10545894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei855Open in IMG/M
3300010400|Ga0134122_10989343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria823Open in IMG/M
3300010859|Ga0126352_1253347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei505Open in IMG/M
3300010866|Ga0126344_1166880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300010869|Ga0126359_1747446All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300012403|Ga0134049_1377942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei970Open in IMG/M
3300012469|Ga0150984_105369750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria713Open in IMG/M
3300012986|Ga0164304_10563580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum844Open in IMG/M
3300014488|Ga0182001_10088398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei933Open in IMG/M
3300014491|Ga0182014_10118911All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300014497|Ga0182008_10880909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum525Open in IMG/M
3300014654|Ga0181525_10186828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1133Open in IMG/M
3300014658|Ga0181519_10340259All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300014968|Ga0157379_11641622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei628Open in IMG/M
3300018034|Ga0187863_10465746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales706Open in IMG/M
3300018465|Ga0190269_10188601All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300018466|Ga0190268_10208623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1075Open in IMG/M
3300018468|Ga0066662_10222892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1514Open in IMG/M
3300018890|Ga0193595_1036160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1678Open in IMG/M
3300018891|Ga0193610_1069067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei943Open in IMG/M
3300018892|Ga0193607_1119033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300018915|Ga0193591_1095499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei954Open in IMG/M
3300018920|Ga0190273_11205936All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300018962|Ga0193589_1211708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei510Open in IMG/M
3300019767|Ga0190267_10634189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales670Open in IMG/M
3300020081|Ga0206354_10976168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300021171|Ga0210405_11299056Not Available534Open in IMG/M
3300021401|Ga0210393_11258646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales594Open in IMG/M
3300022528|Ga0242669_1113484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300022529|Ga0242668_1101153All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300022720|Ga0242672_1008580All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300024225|Ga0224572_1086488All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300024854|Ga0255287_1087689All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025903|Ga0207680_11291826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300025928|Ga0207700_12043512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei500Open in IMG/M
3300025986|Ga0207658_11577584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei600Open in IMG/M
3300027807|Ga0209208_10217364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1045Open in IMG/M
3300027846|Ga0209180_10471614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria705Open in IMG/M
3300027860|Ga0209611_10599643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661608Open in IMG/M
3300027972|Ga0209079_10263123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales587Open in IMG/M
3300028023|Ga0265357_1008134All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300028716|Ga0307311_10257159Not Available520Open in IMG/M
3300028720|Ga0307317_10056045All Organisms → cellular organisms → Bacteria → Proteobacteria1269Open in IMG/M
3300029954|Ga0311331_10350143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum1533Open in IMG/M
3300030872|Ga0265723_1000849All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300030872|Ga0265723_1010034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661666Open in IMG/M
3300030904|Ga0308198_1095558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium516Open in IMG/M
3300030906|Ga0302314_10237672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2181Open in IMG/M
3300031018|Ga0265773_1028033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300031027|Ga0302308_10513466All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300031090|Ga0265760_10386731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei504Open in IMG/M
3300031091|Ga0308201_10045962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1072Open in IMG/M
3300031123|Ga0308195_1064435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria557Open in IMG/M
3300031231|Ga0170824_113215875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661517Open in IMG/M
3300031447|Ga0272435_1044379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1811Open in IMG/M
3300031451|Ga0272426_1015239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4803Open in IMG/M
3300031470|Ga0272432_1014566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6483Open in IMG/M
3300031471|Ga0272439_1073435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2399Open in IMG/M
3300031471|Ga0272439_1226783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum791Open in IMG/M
3300031472|Ga0272437_1096755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2025Open in IMG/M
3300031520|Ga0272428_1037163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4262Open in IMG/M
3300031520|Ga0272428_1070605All Organisms → cellular organisms → Bacteria → Proteobacteria2473Open in IMG/M
3300031520|Ga0272428_1247201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria809Open in IMG/M
3300031669|Ga0307375_10294120All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300031679|Ga0318561_10305435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei870Open in IMG/M
3300031893|Ga0318536_10585571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales558Open in IMG/M
3300031939|Ga0308174_11836648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales521Open in IMG/M
3300031995|Ga0307409_102476467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661548Open in IMG/M
3300032157|Ga0315912_11632851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei507Open in IMG/M
3300034025|Ga0334940_185270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei565Open in IMG/M
3300034163|Ga0370515_0360877All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300034687|Ga0334905_004415All Organisms → cellular organisms → Bacteria → Proteobacteria1996Open in IMG/M
3300034820|Ga0373959_0192939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium535Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.64%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.36%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil6.36%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated6.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.73%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.73%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.82%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.82%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring1.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.82%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.82%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.91%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.91%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.91%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.91%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.91%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.91%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.91%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.91%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.91%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2081372006Soil microbial communities from sample at FACE Site NTS_071 Nevada Test SiteEnvironmentalOpen in IMG/M
3300000095Soil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2EnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001408Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004213Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NAEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005573Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly)EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018890Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1EnvironmentalOpen in IMG/M
3300018891Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 18 hrs after wetting v1EnvironmentalOpen in IMG/M
3300018892Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, bundles v1EnvironmentalOpen in IMG/M
3300018915Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300018962Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 3 min after wetting v1EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024854Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031447Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nordEnvironmentalOpen in IMG/M
3300031451Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nordEnvironmentalOpen in IMG/M
3300031470Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nordEnvironmentalOpen in IMG/M
3300031471Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sudEnvironmentalOpen in IMG/M
3300031472Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstoneEnvironmentalOpen in IMG/M
3300031520Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nordEnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300034025Biocrust microbial communities from Mojave Desert, California, United States - 36SMCEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034687Soil microbial communities from Mojave Desert, California, United States - 1NOCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FNTS_035477302081372006SoilMGEGRGLDVASRRRPGWVSDRVTVPLRPGSAGGGKDPDFWCA
LCrCPGB2aDRAFT_05323223300000095SoilMGEGRGLNVAFRRRPGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEDR*
C688J13580_101750023300001205SoilIMGEGRGLNVAVRRRSGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEDR*
C688J14111_1002016923300001305SoilMGEGRGLNVAVRRRSGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEDR*
JGI20206J14855_102448623300001408Arctic Peat SoilLDVVAGRRPRRVSDRVIVPSRPGNSGGGKDPDFWYAFEGAEDR*
C688J35102_11798634933300002568SoilMGEGHGLNVASRRRPGWVSDRVTVPLRPGNAGGGKDPDFWCAF
C688J35102_12079536513300002568SoilGEGSGLNVVAGRRLGRVSDRAVLLLRLGNASGGKGPDFWYAFEGAEDG*
Ga0058689_1003478413300004016AgaveMGEGRGLNVASRRRSGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEER*
Ga0062384_10074376923300004082Bog Forest SoilVGEGSDLDVVAGRRLRWASDRVIVLPRLGNASGGKDPDFWYAFEGVEDW*
Ga0062387_10073029213300004091Bog Forest SoilMGEGSGLDAVIGRWLWRVSDRVIVLTKLGNAGGGKGPDFWCAFEAAEDW*
Ga0066648_1015339223300004213GroundwaterMGEGSGLDAVAGRRLWRVSDRVIVLLKPGNAGRGKDPGFWCAFEGAEDW*
Ga0062595_10264994313300004479SoilMGEGSGLNAATGQRLWRESDRVIVLLKPGNAGEGKDPDFWCASDGDEDR*
Ga0062380_1040943713300004779Wetland SedimentVGEGSGLDVVAGRRLRRVSDRVVVLSRLGNASGGKDPDFWCAFEGAEDR*
Ga0058860_1218651113300004801Host-AssociatedMGEGSGLNVVAERRLWRVSDRVIVLLRLGNASGGKDPDFWCAFDGVEDW*
Ga0070682_10203449313300005337Corn RhizosphereLGEGSGLNVSDRWRRGWVSDRVIVLLRLGNASGGKDPDFWNACEEAEDW*
Ga0078972_100680713300005573Hot SpringVGEGSGLNDVIGRRHWRVSDRVIVLQRLGNASGGKDPDFWY
Ga0068854_10196438313300005578Corn RhizosphereMGEGSGLNVVAERRLWRVSDRVIVLLRLGNASGGKDPDFW
Ga0097621_10179372523300006237Miscanthus RhizosphereMGEGRGLNVVAERRLWRVSDRVIVLLRLGNASGGKDPDFWCAFDGVEDW*
Ga0075521_1008512623300006642Arctic Peat SoilRPVAGEGSGLDVVAGRRLRRVSDRIVILLRLGNASGGNDLDFRYAFEGAEDR*
Ga0073928_1033514823300006893Iron-Sulfur Acid SpringMGEGSGLNGADRRRHRWESDRVIVPLKPGNAGGGKDPDFWCAC*
Ga0075426_1090252423300006903Populus RhizosphereLGEGSGLNVSDRGRRGWVSDRVIVLLRLGNASGGKDPDFWYAFHQAEER*
Ga0075424_10132746113300006904Populus RhizosphereLGEGSGLNVSDRGRRGWVSDRVIVLLRLGNASGGKDPDFWNACEEAEDW*
Ga0079219_1203760913300006954Agricultural SoilPTVGEGGGLNGADRRRHRWESDRVIVLPKPGNAGGGKDPDFWCAC*
Ga0075435_10203868623300007076Populus RhizosphereMGEGSGLNVSDRWRRGWVSDRVIVLLRLGNASGGKDPDFWNACEEAEDW*
Ga0099829_1016241323300009038Vadose Zone SoilMGEGSGLDAVVGRRLWRVSDRVIVLTKLGNAGGGKGPDFWCAFEGAEDR*
Ga0105103_1026017413300009085Freshwater SedimentMSEGSGLNDVDRRRLRWGSDRVVVLLRLGNASGGKGPDFWCAC*
Ga0114925_1003078023300009488Deep SubsurfaceMGEGSGLNVAFRRQSWRGSDRVIRALKPGNAGRAKDPDFWCAFEEAKDR*
Ga0116229_1156979123300009500Host-AssociatedMGEGSGLDVVAGRRLWRVSDRVIVLPRLGNASGGKDPDFRYAFEGEEDW*
Ga0123519_10003380213300009503Hot SpringVGEGSGLNDVIGRRHWRVSDRVIVLQRLGNASGGKDP
Ga0116230_1027897323300009510Host-AssociatedMGEGSGLNVVAGRRLWRVSDRVIVLPRLGNASGGKDPDFWYAFEGVEDW*
Ga0116113_110427813300009638PeatlandLGEGSGLDVVAGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR*
Ga0116228_1074080623300009701Host-AssociatedSGLNVVAGRRLRRVSDRVIVLPRLGNASGGKDPDFWYAFEGAEDW*
Ga0116227_1007563823300009709Host-AssociatedMGEGSDLDVVAGRRLWRVSDRVIVLPRLGNASGGKDPDFW*
Ga0116227_1058895623300009709Host-AssociatedGHEGSGLNVADRRRCLRESDGVIVLLRPGNAGGGKDPDFWCASEDREGMVIGESL*
Ga0126312_1020669323300010041Serpentine SoilLGEIRQGEGSGLNVAQERRRWRKSDRAIVLPRLGNASGGKGPDFWCAFEEAEDG*
Ga0126310_1054589413300010044Serpentine SoilVGEGSGLDVVAGRRLRRVSDRVIVLLRPGNAGGGKDPDFWCASEDGEG
Ga0134122_1098934323300010400Terrestrial SoilGRPIMGEGSGLNVVAERRLWRVSDRVIVLLRLGNASGGKDPDFWCAFEGAEDW*
Ga0126352_125334713300010859Boreal Forest SoilMNEGSGLNVVAGRRLRRVSDGVIVLSKLGNAGGGKDPDFWCAFEVAEER*
Ga0126344_116688013300010866Boreal Forest SoilVAGRRLRRVSDRVVILLRLGNASGGKDPDFWYACEAGEER*
Ga0126359_174744623300010869Boreal Forest SoilLGEGSGLDVVAGRRPRWVSDRVVIPLRLGNTSGGKDPDFWYAFEGAEDR*
Ga0134049_137794213300012403Grasslands SoilMQATGEPRFGEGSGLDVVAGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR*
Ga0150984_10536975013300012469Avena Fatua RhizosphereMGEGSGLNVVAGRRLGRVSDRAVILLRLGNASGGKGPDFWYAFEGAEDG*
Ga0164304_1056358023300012986SoilGSGLNAATGQRLWRESDRVIVLLKPGNAGEGKDPDFWCASDGDEDR*
Ga0182001_1008839813300014488SoilMGEGRGLNVASRRRSGWVSDRVTVPLRLGNAGGGKDPDFWCAFNQAEER*
Ga0182014_1011891113300014491BogITGEGSGLNDADRRRLRWVSDRVIVLPRLGNASGGKDPDFWYAFEGTEDW*
Ga0182008_1088090913300014497RhizosphereVVAERRLWRASDRVTVLQRLGNASGGKDPDFWCAFEGVEDW*
Ga0181525_1018682813300014654BogVGEGSGLNDVVGRRHWRVSDRVVVLLKLGNASGGKDPDFWCAFDEAEER*
Ga0181519_1034025923300014658BogSGLDAVIGRWLWRVSDRVIVLPRLGNASGGKGPDFWCAFDGAEEW*
Ga0157379_1164162213300014968Switchgrass RhizosphereMSEGSGLNGADRRRHRWESDRVVVPLNPGNAGGGK
Ga0187863_1046574623300018034PeatlandLGEGSGLDVVAGRRPRWVSDRVVIPLRLGNTSGGKDPAFWYAFEGAEDR
Ga0190269_1018860123300018465SoilMGEGRGLNVAFRRRPGWVSDRVTVPLRPGNAGGGKDPDFWCAFDQAEDR
Ga0190268_1020862323300018466SoilMGEGRGLDVASRRRPGWVSDRVTVPLRPGSAGGGKGPDFWCAFDQAEDR
Ga0066662_1022289223300018468Grasslands SoilMGEGRGLNVASRRRSGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEER
Ga0193595_103616023300018890SoilMGEGRGLNVAFRRRPGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEDR
Ga0193610_106906713300018891SoilMGEGRGLNVASRRRPGWVSDRVAVPLRPGNAGGGKDPDFWCAFNQAEDR
Ga0193607_111903313300018892SoilMGEGRGLNVAFRRRPGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAE
Ga0193591_109549923300018915SoilMGEGRGLNVAVRRRPGWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEDR
Ga0190273_1120593623300018920SoilRPAMGEGSDLDVVAGRRLWRVSDRAVVPTRLGNASGGKGPDFWRAFEVAEER
Ga0193589_121170823300018962SoilMGEGRGLNVAFRRRPGWVSDRVTVPLRPGNAGGGKDPDF
Ga0190267_1063418913300019767SoilMGEGSGLDVVAGRRLWRVSDRVVVLLRLGNASGGKGPDFWYAFEGAEDW
Ga0206354_1097616813300020081Corn, Switchgrass And Miscanthus RhizosphereGRPVAGEGSGFNVVAGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR
Ga0210405_1129905623300021171SoilMGEGSGLNVAAGRRHRWVSDRVIGLLRPGNAGGGKDPDFWCAS
Ga0210393_1125864623300021401SoilLGEGSGLDVVAGRRPRWVSDRVVIPLRLGNTSGGKDPDFWYAFEGAEDR
Ga0242669_111348423300022528SoilEGSGLNVVVGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR
Ga0242668_110115313300022529SoilGEGSDLDVVAGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR
Ga0242672_100858013300022720SoilNRGRPNRHEGSDLDVVAGRRCWWESDRVVLPMKPGNAGGGKGPDFWCAFDGDEDW
Ga0224572_108648823300024225RhizosphereAGEGSDLDVVAGRRPGRVSDRVIVLSRPGNFGGGKDPDFWYAFEGAEDR
Ga0255287_108768913300024854FreshwaterVGEGSGLNIVAGRRLRRVSDRVVVPLRPGNAGGGKDPDFWRAFEAVEER
Ga0207680_1129182613300025903Switchgrass RhizosphereMGEGSGLNVVAERRLWRVSDRVIVLLRLGNASGGKDPDFWCAFDGVEDW
Ga0207700_1204351213300025928Corn, Switchgrass And Miscanthus RhizosphereMGEGSGLNVVAGRRFGRVSDRAVLLLRLGNASGGKGPDFWRAYRRGRGSVT
Ga0207658_1157758423300025986Switchgrass RhizosphereMGEGSGLNVVAERRLWRVSDRVIVLLRLGNASGGKDPDFWCA
Ga0209734_110069513300027535Forest SoilMGEGSGLNVAFRRRLWRESDRVLRALRPGNAGGAKGPDFW
Ga0209208_1021736413300027807Host-AssociatedMGEGSGLNVVAGRRLWRVSDRVIVLPRLGNASGGKDPDFWYAFEGVEDW
Ga0209180_1047161413300027846Vadose Zone SoilMGEGSGLDAVVGRRLWRVSDRVIVLTKLGNAGGGKGPDFWCAFEGAEDR
Ga0209611_1059964323300027860Host-AssociatedMGEGSGLDVVAGRRLWRVSDRVIVLPRLGNASGGKDPDFRYAFEGEEDW
Ga0209079_1026312313300027972Freshwater SedimentMSEGSGLNDVDRRRLRWGSDRVVVLLRLGNASGGKGPDFWCAC
Ga0265357_100813413300028023RhizosphereLGEGSGLDVVAGQRPRWVSDRVVILLRLGNTSGGKDPDFWYAFEGAEDR
Ga0307311_1025715913300028716SoilVLSEGSGLNGAVGHRLERESDRVVVPMKLGNAGGGK
Ga0307317_1005604523300028720SoilVLSEGSGLNGAVGHRLERESDRVVVPMKLGNAGGGKDPDFWCAC
Ga0311331_1035014333300029954BogSGLNVVAGRRLRRVSDRVVIPLRLGNASGGKDPDFWYAFEGAEDR
Ga0265723_100084923300030872SoilSGLNVVVGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR
Ga0265723_101003423300030872SoilLGEGSGLDVVAGQRPRWVSDRVVILSRLGNTSGGKDPDFWYAFEGAEHW
Ga0308198_109555813300030904SoilVLSEGSGLNGAVGHRLERESDRVVVPMKLGNAGGGKD
Ga0302314_1023767233300030906PalsaMGEGSGLDAVIGRWLWRVSDRVIVLTKLGNAGGGKGPDFWCAFEGTEDW
Ga0265773_102803323300031018SoilREGEAGQWGRPVLGEGSGLDDLAGRRPRWVSDRVVIPLRRGNTSGGKDPDFWYAFEGAED
Ga0302308_1051346623300031027PalsaLNGVAGRRLRRVSDRVVILLRLGNASGGKDPDFWYAFEGAEDR
Ga0265760_1038673113300031090SoilLGEGSGLDVVAGRRPRWVSDKVVILSRLGNTSGGKDPDFWYAFEG
Ga0308201_1004596223300031091SoilMGEGRGLNAAVRRRSRWVSDRVTVPLRPGNAGGGKDPDFWCAFNQAEDR
Ga0308195_106443513300031123SoilGEGSGLNVVAGRRLWRVSDRVVVLPRLGNSSGGKGPDFWYAFEGAEDW
Ga0170824_11321587513300031231Forest SoilLGEGSGLDVVAGRRPRWVSDRVVIPLRLGNTSGGKDPDFWYAFEEAEDR
Ga0272435_104437923300031447RockMGEGSGLDVVAGRRLWRVSDRVIVPLKLGNASGGKDPDFWCAFEAAEDW
Ga0272426_101523973300031451RockMGEGSGLDVVTGRRLWRVSDRVIVLSKLGNAGGGKNPDVWCAFEAAEDW
Ga0272432_101456623300031470RockMAEGSGLDVVAGRRLWRVSDRVIVLLRPGNAGGGKGPDFWCAFEIAEDW
Ga0272439_107343523300031471RockMGAGSGLDVVAGRRLWRVSDRVIVPLKLGNASGGKDPDFWCAFEAAEDW
Ga0272439_122678313300031471RockMGEGSGLDAVAGRRLWRVSDRVIVLLRLGNASVGKDPGFWCAFEAVEDW
Ga0272437_109675513300031472RockMGEGSGLDVVVGRRLWRVSDRVIVLLRPGNAGGGKDLDFWCAFEIAEDW
Ga0272428_103716323300031520RockMGEGSGLDAVVGRRLWRVSDRVIVLLRPGNAGGGKDPDFWCAFEIAEDW
Ga0272428_107060533300031520RockMGEGSGLDVVVGRRLWRVSDRVIVLLRPGNAGGGKDPDFWCAFEIAEDW
Ga0272428_124720123300031520RockLGEARHGEGSGLDVVAERRLRRVSDRVIVLLRLGNASGGKDPDFWCAFEGVEDW
Ga0307375_1029412023300031669SoilGNRWRPAVGEGSGLNDVIGRRHWRVSDRVIVLQRLGNASGGKDPDFWYAFEEAEDW
Ga0318561_1030543523300031679SoilVSEGSGLNIAERRRLWRESDRVIRPLKPGNAGGGKDPDFWCAFEDGKVT
Ga0318536_1058557113300031893SoilVSEGSGLNVAERRRLWRESDRVIRPLKPGNASGGKDPDFWCAFE
Ga0308174_1183664823300031939SoilMGEGSGLNVVAGRRLWRVSDRVVVLPRLGNVSGGKDPDFWYAFEGAEDW
Ga0307409_10247646713300031995RhizosphereLGEIRQGEGSGLNVAQERRRWRKSDRAIVLPRLGNPSGGKGPDFW
Ga0306924_1140835713300032076SoilMCESSGLNVASRRRPCRESDRVVRALRPGNAGGAKGPDF
Ga0315912_1163285113300032157SoilMSEGSGLNDVDRRRLRWGSDRVVVLLRLGNASGGKGPDLWCAC
Ga0334940_185270_458_5653300034025BiocrustMGEGRGLNVAFRRRPEWVSDRVTVPLRPGDAGGGKD
Ga0370515_0360877_303_4523300034163Untreated Peat SoilMGEGSGLDVVAGQRPRWVSDRVVILLRLGNTSGGKDPDFWYAFEGAEDR
Ga0334905_004415_1442_15913300034687SoilMGEGRGLNAASRGRPGWVSDRVTVPVRPGNAGGGKDPDFWCASDQVEDR
Ga0373959_0192939_2_1303300034820Rhizosphere SoilMSEGSGLNGADRRRHRWESDRVVVPLNPGNAGGGKDPDFWCAC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.