Basic Information | |
---|---|
Family ID | F087923 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 43 residues |
Representative Sequence | MNKPTDSYSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.27 % |
% of genes near scaffold ends (potentially truncated) | 27.27 % |
% of genes from short scaffolds (< 2000 bps) | 86.36 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.727 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.273 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.727 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.091 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF13545 | HTH_Crp_2 | 49.09 |
PF00144 | Beta-lactamase | 30.00 |
PF00672 | HAMP | 0.91 |
PF00027 | cNMP_binding | 0.91 |
PF05228 | CHASE4 | 0.91 |
PF05962 | HutD | 0.91 |
PF13485 | Peptidase_MA_2 | 0.91 |
PF14827 | dCache_3 | 0.91 |
PF01546 | Peptidase_M20 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 30.00 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 30.00 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 30.00 |
COG3322 | Extracellular (periplasmic) sensor domain CHASE (specificity unknown) | Signal transduction mechanisms [T] | 0.91 |
COG3758 | Various environmental stresses-induced protein Ves (function unknown) | Function unknown [S] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.73 % |
Unclassified | root | N/A | 17.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8843293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
2088090015|GPICI_9044495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6279 | Open in IMG/M |
2088090015|GPICI_9253111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11193 | Open in IMG/M |
2162886012|MBSR1b_contig_11158047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100812582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300000890|JGI11643J12802_10229650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
3300000890|JGI11643J12802_10549894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 996 | Open in IMG/M |
3300000956|JGI10216J12902_109277119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300001431|F14TB_100253680 | Not Available | 526 | Open in IMG/M |
3300003319|soilL2_10086165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2710 | Open in IMG/M |
3300004114|Ga0062593_100370312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
3300004114|Ga0062593_100843734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
3300004157|Ga0062590_100986619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
3300004463|Ga0063356_100058814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3925 | Open in IMG/M |
3300004463|Ga0063356_101856702 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300004463|Ga0063356_104198249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300004463|Ga0063356_106333168 | Not Available | 507 | Open in IMG/M |
3300005332|Ga0066388_103798007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
3300005332|Ga0066388_104499240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
3300005336|Ga0070680_100174218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1811 | Open in IMG/M |
3300005345|Ga0070692_10023532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3019 | Open in IMG/M |
3300005438|Ga0070701_11107221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
3300005444|Ga0070694_100242817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1359 | Open in IMG/M |
3300005444|Ga0070694_100414561 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300005458|Ga0070681_11419284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300005459|Ga0068867_100495617 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300005548|Ga0070665_101701329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
3300005564|Ga0070664_100262183 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300005564|Ga0070664_101253612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
3300005614|Ga0068856_102616203 | Not Available | 510 | Open in IMG/M |
3300005841|Ga0068863_101101171 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006049|Ga0075417_10197811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
3300006058|Ga0075432_10233404 | Not Available | 740 | Open in IMG/M |
3300006844|Ga0075428_100024520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6675 | Open in IMG/M |
3300006844|Ga0075428_100028778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6149 | Open in IMG/M |
3300006844|Ga0075428_100120550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2856 | Open in IMG/M |
3300006844|Ga0075428_101761102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
3300006844|Ga0075428_101909362 | Not Available | 617 | Open in IMG/M |
3300006845|Ga0075421_100125289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3223 | Open in IMG/M |
3300006845|Ga0075421_101787202 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300006845|Ga0075421_102380125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300006847|Ga0075431_100356969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1469 | Open in IMG/M |
3300006876|Ga0079217_10349604 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300006894|Ga0079215_10760525 | Not Available | 668 | Open in IMG/M |
3300006894|Ga0079215_11547816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300006918|Ga0079216_10374983 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300006969|Ga0075419_10184225 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300007004|Ga0079218_10282127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
3300007004|Ga0079218_10610279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
3300007004|Ga0079218_12756395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
3300009147|Ga0114129_12034119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300009156|Ga0111538_10036193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6381 | Open in IMG/M |
3300009162|Ga0075423_11665514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
3300009174|Ga0105241_12262320 | Not Available | 540 | Open in IMG/M |
3300010362|Ga0126377_10717656 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300010397|Ga0134124_11816451 | Not Available | 644 | Open in IMG/M |
3300010397|Ga0134124_12717045 | Not Available | 538 | Open in IMG/M |
3300011107|Ga0151490_1842320 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300012916|Ga0157310_10162937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300018422|Ga0190265_10463979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
3300018422|Ga0190265_11366263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
3300018429|Ga0190272_10415257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1105 | Open in IMG/M |
3300018476|Ga0190274_10181805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1823 | Open in IMG/M |
3300019360|Ga0187894_10056424 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
3300019361|Ga0173482_10342397 | Not Available | 674 | Open in IMG/M |
3300022880|Ga0247792_1010104 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
3300025893|Ga0207682_10267486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 798 | Open in IMG/M |
3300025901|Ga0207688_10214109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
3300025901|Ga0207688_10768226 | Not Available | 610 | Open in IMG/M |
3300025912|Ga0207707_10322777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1333 | Open in IMG/M |
3300025930|Ga0207701_10380915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
3300025938|Ga0207704_10494232 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300025945|Ga0207679_10229933 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300026023|Ga0207677_11986041 | Not Available | 541 | Open in IMG/M |
3300026067|Ga0207678_10587906 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300026089|Ga0207648_10607540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
3300026095|Ga0207676_10025736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4368 | Open in IMG/M |
3300026116|Ga0207674_10125566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2532 | Open in IMG/M |
3300027873|Ga0209814_10141787 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300027880|Ga0209481_10091029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
3300027886|Ga0209486_10336713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
3300027909|Ga0209382_10630910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
3300027909|Ga0209382_11106366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
3300028380|Ga0268265_10249610 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300028608|Ga0247819_10892520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300031184|Ga0307499_10174507 | Not Available | 646 | Open in IMG/M |
3300031228|Ga0299914_11215110 | Not Available | 603 | Open in IMG/M |
3300031538|Ga0310888_10820385 | Not Available | 577 | Open in IMG/M |
3300031547|Ga0310887_10452277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300031548|Ga0307408_100027365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3928 | Open in IMG/M |
3300031548|Ga0307408_100300949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
3300031548|Ga0307408_100644491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300031548|Ga0307408_101551499 | Not Available | 628 | Open in IMG/M |
3300031562|Ga0310886_11074233 | Not Available | 518 | Open in IMG/M |
3300031824|Ga0307413_11011216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
3300031858|Ga0310892_10165419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1298 | Open in IMG/M |
3300031892|Ga0310893_10320520 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300031901|Ga0307406_10706854 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300031908|Ga0310900_10399419 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300031908|Ga0310900_11558576 | Not Available | 558 | Open in IMG/M |
3300031940|Ga0310901_10038181 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300031940|Ga0310901_10188045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
3300031943|Ga0310885_10407455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300031995|Ga0307409_102918206 | Not Available | 505 | Open in IMG/M |
3300032003|Ga0310897_10027027 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
3300032005|Ga0307411_10966115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
3300032017|Ga0310899_10377708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300032126|Ga0307415_100273853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
3300032211|Ga0310896_10017853 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
3300033412|Ga0310810_10509434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.73% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 8.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_00216540 | 2088090015 | Soil | MNKPTDSFSLRSVVEKVFAGFAAAAIIAFVSAGAVAMCFPNIA |
GPICI_00075160 | 2088090015 | Soil | MNKHTDSLSLRTVVEKVFVGFAAAAIVAFVSLGTVAICFPTVVA |
GPICI_01789970 | 2088090015 | Soil | MNQHTDSLSLRTVVEKVFVGFAAAAIVAFVSAGTVAICFPTVVA |
MBSR1b_0836.00007050 | 2162886012 | Miscanthus Rhizosphere | MNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
INPhiseqgaiiFebDRAFT_1008125822 | 3300000364 | Soil | MNRPTDSLSLRHVVEKVFAGCAAVVIIAFVAAGTVAMCFPNIA* |
JGI11643J12802_102296502 | 3300000890 | Soil | MNRHNDSYSLRAVVEKVFAGIAATAIIAFVSVGTVAMCFPTVA* |
JGI11643J12802_105498941 | 3300000890 | Soil | MNRPHDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPTVA* |
JGI10216J12902_1092771191 | 3300000956 | Soil | MNKPTDSYSLRNVVEKVFAGFAAAAILAFVSAGTVAMCFPNIA* |
F14TB_1002536802 | 3300001431 | Soil | MNKYTDSFSLRTVVEKAFAGVAAAVILAFVSAGTVAMCFPNIVA* |
soilL2_100861654 | 3300003319 | Sugarcane Root And Bulk Soil | MNRPNDSFSFRTVVEKVFAGIAAAAIIGFISAGTVAICFPPVA* |
Ga0062593_1003703122 | 3300004114 | Soil | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA* |
Ga0062593_1008437342 | 3300004114 | Soil | MNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA* |
Ga0062590_1009866192 | 3300004157 | Soil | MNQHTDSLSLRTVVEKVFVGFAAAAIVAFVSAGTVAICFPTV |
Ga0063356_1000588143 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNQHTDSLSLRTVVEKVFVGFAAAAIVAFVSAGTVAICFPTVVA* |
Ga0063356_1018567022 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNLA* |
Ga0063356_1041982492 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNKHTDSLSLRTVVEKVFVGFAAAVIVVFVSVGTVAMCFPTLVA* |
Ga0063356_1063331681 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNRPNDSFSLRTVVEKVLAGIAAAAIIGFISAGTLAMCFSTVA* |
Ga0066388_1037980072 | 3300005332 | Tropical Forest Soil | MNKHNDSYSLRSVVEKVFAGIAAAVIITFISAGTLAMCFPNIA* |
Ga0066388_1044992402 | 3300005332 | Tropical Forest Soil | MNRHNDSYSLRTVVEKVFAGVAAAVIIAFVSAGTVAMCFPTLA* |
Ga0070680_1001742181 | 3300005336 | Corn Rhizosphere | EETHMNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA* |
Ga0070692_100235323 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKPTDSYSLRSVVEKVFASFAAAAILAFVSAGTVAMCFPNVA* |
Ga0070701_111072212 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA* |
Ga0070694_1002428172 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRPHDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA* |
Ga0070694_1004145611 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA* |
Ga0070681_114192841 | 3300005458 | Corn Rhizosphere | MNKPTDSFSLRSVVEKVFAGFAAAAIIAFVSAGAVAMCFPNIA* |
Ga0068867_1004956171 | 3300005459 | Miscanthus Rhizosphere | NDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA* |
Ga0070665_1017013292 | 3300005548 | Switchgrass Rhizosphere | MNKHTDSLSLRTVVEKVFVGFAAAAIVAFVSIGTVAMCFPTVVA* |
Ga0070664_1002621831 | 3300005564 | Corn Rhizosphere | HMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA* |
Ga0070664_1012536122 | 3300005564 | Corn Rhizosphere | MNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCF |
Ga0068856_1026162031 | 3300005614 | Corn Rhizosphere | LRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA* |
Ga0068863_1011011711 | 3300005841 | Switchgrass Rhizosphere | MNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA* |
Ga0075417_101978112 | 3300006049 | Populus Rhizosphere | MNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAMCFPTVA* |
Ga0075432_102334041 | 3300006058 | Populus Rhizosphere | HMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLVMCFPTVA* |
Ga0075428_1000245205 | 3300006844 | Populus Rhizosphere | MNKPTDSFALRTVVEKVFAGIAAAMIIGFVSAGTVAMCFPNIA* |
Ga0075428_1000287784 | 3300006844 | Populus Rhizosphere | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPTVA* |
Ga0075428_1001205504 | 3300006844 | Populus Rhizosphere | MNKHTDNLSIRAIGEKVFAGIAATAIIAFISLGTVAMCFPNVA* |
Ga0075428_1017611022 | 3300006844 | Populus Rhizosphere | MNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAMC |
Ga0075428_1019093622 | 3300006844 | Populus Rhizosphere | MNKHTDSLWLRTVVEKVFVGFAATAIVAFVSVGTVAMCIPTVVA* |
Ga0075421_1001252893 | 3300006845 | Populus Rhizosphere | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCLPTVA* |
Ga0075421_1017872022 | 3300006845 | Populus Rhizosphere | MNKPTDNLSIRAVFEKVFAGIAATAIIAFISAGTVAMCFPNVA* |
Ga0075421_1023801252 | 3300006845 | Populus Rhizosphere | MSKHTDSFSLRTVIEKAFAGVAAVVIIAFVSVGTLAMCFPTTIA* |
Ga0075431_1003569693 | 3300006847 | Populus Rhizosphere | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPSVA* |
Ga0079217_103496042 | 3300006876 | Agricultural Soil | MDKHTDSFSFRCTIEKVFAGFAAAVIVAFVGAGTAVMCFPNLA* |
Ga0079215_107605251 | 3300006894 | Agricultural Soil | MNKHTNSFSLRTAVEKVFAGFAAAVIIVFVSAGTAVMCFPTLA* |
Ga0079215_115478162 | 3300006894 | Agricultural Soil | MDKHTDSFSFRSTIEKVFAGFAAAMIVAFVGAGTAVMCFPNLA* |
Ga0079216_103749832 | 3300006918 | Agricultural Soil | MDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTVVMCFPNIA* |
Ga0075419_101842252 | 3300006969 | Populus Rhizosphere | MNKHTYSLWLRTVVEKVFVGFAATAIVAFVSVGTVAMCIPTVVA* |
Ga0079218_102821272 | 3300007004 | Agricultural Soil | MDKHTDSLSFRSTIEKLFAGFAAAMIVAFVGAGTAVMCFPNLA* |
Ga0079218_106102792 | 3300007004 | Agricultural Soil | MDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA* |
Ga0079218_127563952 | 3300007004 | Agricultural Soil | MDKHTDSFSFRCTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA* |
Ga0114129_120341191 | 3300009147 | Populus Rhizosphere | MNKHTDNLSIRAIGEKVFAGIAATAIIAFISLGTVAM |
Ga0111538_100361938 | 3300009156 | Populus Rhizosphere | MNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAICFPTVA* |
Ga0075423_116655142 | 3300009162 | Populus Rhizosphere | MATDPRKTHMNKPNDSLSLRTVVEKVFAGFAAAVILTFISAGTVVMCFPN |
Ga0105241_122623202 | 3300009174 | Corn Rhizosphere | ETHMNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA* |
Ga0126377_107176562 | 3300010362 | Tropical Forest Soil | MNKPNDSLSLRSIVEKVFAGFAAAAIIAFVSAGTVAMCFPNVA* |
Ga0134124_118164512 | 3300010397 | Terrestrial Soil | MANRSKEIQMSKHTDSLSLRNVVEKVFAGAAAAAIIVFVSAGTVAMCFPSIA* |
Ga0134124_127170451 | 3300010397 | Terrestrial Soil | MNKPTDSHSLRSVVEKVFAGFAATAILAFVSAGTVAMCFPNVA* |
Ga0151490_18423202 | 3300011107 | Soil | LRSVVEKAFAGIAAAAIIAFVSAGTVAMCFPNVA* |
Ga0157310_101629372 | 3300012916 | Soil | MNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCF |
Ga0190265_104639792 | 3300018422 | Soil | MDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA |
Ga0190265_113662632 | 3300018422 | Soil | MKKHTDSFSMRSVVEKVFAGFAAAVIFVFVSVGTAAMCFPNIA |
Ga0190272_104152572 | 3300018429 | Soil | MDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTVVMCFPNIA |
Ga0190274_101818052 | 3300018476 | Soil | MDKHTDSFSFRSTIEKVFAGFAATVIIAFIGAGTAVMCFPNIA |
Ga0187894_100564242 | 3300019360 | Microbial Mat On Rocks | MNKPTDSFSLRNMVEKVFAGFAAAVIVAFVGAGTAVMCFPNIA |
Ga0173482_103423972 | 3300019361 | Soil | MNKPTDSHSLRSVVEKVFAGIAAAAIIVFVSAGTVAMCFPNVA |
Ga0247792_10101042 | 3300022880 | Soil | MNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
Ga0207682_102674862 | 3300025893 | Miscanthus Rhizosphere | DGYRPEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA |
Ga0207688_102141091 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKPTDSHSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
Ga0207688_107682262 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | DSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA |
Ga0207707_103227773 | 3300025912 | Corn Rhizosphere | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA |
Ga0207701_103809151 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVALSQDGAAE |
Ga0207704_104942321 | 3300025938 | Miscanthus Rhizosphere | PDGYRPEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA |
Ga0207679_102299333 | 3300025945 | Corn Rhizosphere | PEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA |
Ga0207677_119860411 | 3300026023 | Miscanthus Rhizosphere | THMNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA |
Ga0207678_105879062 | 3300026067 | Corn Rhizosphere | MNKPTDSHSLRSVVEKVFASFAAAAILAFVSAGTVAMCFPNVA |
Ga0207648_106075402 | 3300026089 | Miscanthus Rhizosphere | MNKPTDSYSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA |
Ga0207676_100257367 | 3300026095 | Switchgrass Rhizosphere | KPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
Ga0207674_101255663 | 3300026116 | Corn Rhizosphere | MNKPTDSYSLRSDIEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
Ga0209814_101417872 | 3300027873 | Populus Rhizosphere | MNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAMCFPTVA |
Ga0209481_100910292 | 3300027880 | Populus Rhizosphere | MNKHTDNLSIRAIGEKVFAGIAATAIIAFISLGTVAMCFPNVA |
Ga0209486_103367132 | 3300027886 | Agricultural Soil | MDKHTDSLSFRSTIEKLFAGFAAAMIVAFVGAGTAVMCFPNLA |
Ga0209382_106309101 | 3300027909 | Populus Rhizosphere | MSKHTDSFSLRTVIEKAFAGVAAVVIIAFVSVGTLAMCFPTTIA |
Ga0209382_111063661 | 3300027909 | Populus Rhizosphere | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCLPTVA |
Ga0268265_102496102 | 3300028380 | Switchgrass Rhizosphere | MNKHTDSLSLRTVVEKVFVGFAAAAIVAFVSIGTVAMCFPTVVA |
Ga0247819_108925202 | 3300028608 | Soil | MNRPNDSFSLRTVVEKVFGGIAAAAIIGFISAGTLAMCFPTVA |
Ga0307499_101745072 | 3300031184 | Soil | SLSLRAVVEKVFAGVAATAIIAFISAGTVAMCFPNVA |
Ga0299914_112151102 | 3300031228 | Soil | MDKHTDSFSLRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA |
Ga0310888_108203851 | 3300031538 | Soil | MNKPNDSHSLRSIVEKVFAGFAAAAIIALVSAGTVAMCFPNVA |
Ga0310887_104522771 | 3300031547 | Soil | MNKPNDSYSLRSIVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA |
Ga0307408_1000273651 | 3300031548 | Rhizosphere | MNKPTDSFSLRSVVEKVFAGFAAAAITAFVSAGTVAMCFPNIA |
Ga0307408_1003009492 | 3300031548 | Rhizosphere | MDKHTDSFSFRSTIEKVFAGFAAAVIIAFVGAGTAVMCFPNIA |
Ga0307408_1006444911 | 3300031548 | Rhizosphere | MNRPTDSYSLRSVVEKLFAGIAAVAILVFVSAGTVAMCFPNVA |
Ga0307408_1015514991 | 3300031548 | Rhizosphere | MNRPNDSLSLRALIEKVFAGVAAAFIIAFVSVGTVAMCFPTVA |
Ga0310886_110742331 | 3300031562 | Soil | RPEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTVAMCFPTVA |
Ga0307413_110112162 | 3300031824 | Rhizosphere | MNKHTDSFSFRSTIEKVFAGFAAAVIIAFVGAGTAVMCFPNIA |
Ga0310892_101654192 | 3300031858 | Soil | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPTVA |
Ga0310893_103205201 | 3300031892 | Soil | SLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
Ga0307406_107068541 | 3300031901 | Rhizosphere | TDSFSFRSTIEKVFAGFAAAVIIAFVGAGTAVMCFPNIA |
Ga0310900_103994192 | 3300031908 | Soil | SLRSIVEKVFAGFAAAAILAFVSAGTVAMCFPNVA |
Ga0310900_115585761 | 3300031908 | Soil | MNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA |
Ga0310901_100381812 | 3300031940 | Soil | MNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPTVA |
Ga0310901_101880451 | 3300031940 | Soil | MNKPNDSHSLRSIVEKVFAGFAAAAIIAFVSAGTVAMCFPNVA |
Ga0310885_104074551 | 3300031943 | Soil | MNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTVAMCFPNVA |
Ga0307409_1029182062 | 3300031995 | Rhizosphere | THMNRPTDSYSLRSVVEKLFAGIAAVAILVFVSAGTVAMCFPNVA |
Ga0310897_100270272 | 3300032003 | Soil | MNKPTDSYSLRSVIEKVFAGFAAAAIIALVSAGTVAMCFPNVA |
Ga0307411_109661152 | 3300032005 | Rhizosphere | MDKHTDSFSFRSTIEKVFAGFAAAVIIAVVGAGTAVMCFPNIA |
Ga0310899_103777082 | 3300032017 | Soil | MNKPNDSLSLRTVVEKVFAGFAAAVILTFISAGTVVMCFPNVA |
Ga0307415_1002738532 | 3300032126 | Rhizosphere | MNKHTDSFSFRSTIEKVFAGFAATVIIAFVGAGTAVMCFPNIA |
Ga0310896_100178531 | 3300032211 | Soil | DSHSLRSIVEKVFAGFAAAAIIALVSAGTVAMCFPNVA |
Ga0310810_105094342 | 3300033412 | Soil | MNQPTDSNSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA |
⦗Top⦘ |