NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087923

Metagenome / Metatranscriptome Family F087923

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087923
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 43 residues
Representative Sequence MNKPTDSYSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA
Number of Associated Samples 82
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.27 %
% of genes near scaffold ends (potentially truncated) 27.27 %
% of genes from short scaffolds (< 2000 bps) 86.36 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.727 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(17.273 % of family members)
Environment Ontology (ENVO) Unclassified
(32.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.091 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13545HTH_Crp_2 49.09
PF00144Beta-lactamase 30.00
PF00672HAMP 0.91
PF00027cNMP_binding 0.91
PF05228CHASE4 0.91
PF05962HutD 0.91
PF13485Peptidase_MA_2 0.91
PF14827dCache_3 0.91
PF01546Peptidase_M20 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 30.00
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 30.00
COG2367Beta-lactamase class ADefense mechanisms [V] 30.00
COG3322Extracellular (periplasmic) sensor domain CHASE (specificity unknown)Signal transduction mechanisms [T] 0.91
COG3758Various environmental stresses-induced protein Ves (function unknown)Function unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.73 %
UnclassifiedrootN/A17.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_8843293All Organisms → cellular organisms → Bacteria → Proteobacteria1046Open in IMG/M
2088090015|GPICI_9044495All Organisms → cellular organisms → Bacteria → Proteobacteria6279Open in IMG/M
2088090015|GPICI_9253111All Organisms → cellular organisms → Bacteria → Proteobacteria11193Open in IMG/M
2162886012|MBSR1b_contig_11158047All Organisms → cellular organisms → Bacteria → Proteobacteria829Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100812582All Organisms → cellular organisms → Bacteria → Proteobacteria979Open in IMG/M
3300000890|JGI11643J12802_10229650All Organisms → cellular organisms → Bacteria → Proteobacteria873Open in IMG/M
3300000890|JGI11643J12802_10549894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales996Open in IMG/M
3300000956|JGI10216J12902_109277119All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300001431|F14TB_100253680Not Available526Open in IMG/M
3300003319|soilL2_10086165All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2710Open in IMG/M
3300004114|Ga0062593_100370312All Organisms → cellular organisms → Bacteria → Proteobacteria1264Open in IMG/M
3300004114|Ga0062593_100843734All Organisms → cellular organisms → Bacteria → Proteobacteria918Open in IMG/M
3300004157|Ga0062590_100986619All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300004463|Ga0063356_100058814All Organisms → cellular organisms → Bacteria → Proteobacteria3925Open in IMG/M
3300004463|Ga0063356_101856702All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300004463|Ga0063356_104198249All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300004463|Ga0063356_106333168Not Available507Open in IMG/M
3300005332|Ga0066388_103798007All Organisms → cellular organisms → Bacteria → Proteobacteria771Open in IMG/M
3300005332|Ga0066388_104499240All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300005336|Ga0070680_100174218All Organisms → cellular organisms → Bacteria → Proteobacteria1811Open in IMG/M
3300005345|Ga0070692_10023532All Organisms → cellular organisms → Bacteria → Proteobacteria3019Open in IMG/M
3300005438|Ga0070701_11107221All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300005444|Ga0070694_100242817All Organisms → cellular organisms → Bacteria → Proteobacteria1359Open in IMG/M
3300005444|Ga0070694_100414561All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300005458|Ga0070681_11419284All Organisms → cellular organisms → Bacteria → Proteobacteria618Open in IMG/M
3300005459|Ga0068867_100495617All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300005548|Ga0070665_101701329All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300005564|Ga0070664_100262183All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300005564|Ga0070664_101253612All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300005614|Ga0068856_102616203Not Available510Open in IMG/M
3300005841|Ga0068863_101101171All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006049|Ga0075417_10197811All Organisms → cellular organisms → Bacteria → Proteobacteria951Open in IMG/M
3300006058|Ga0075432_10233404Not Available740Open in IMG/M
3300006844|Ga0075428_100024520All Organisms → cellular organisms → Bacteria → Proteobacteria6675Open in IMG/M
3300006844|Ga0075428_100028778All Organisms → cellular organisms → Bacteria → Proteobacteria6149Open in IMG/M
3300006844|Ga0075428_100120550All Organisms → cellular organisms → Bacteria → Proteobacteria2856Open in IMG/M
3300006844|Ga0075428_101761102All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300006844|Ga0075428_101909362Not Available617Open in IMG/M
3300006845|Ga0075421_100125289All Organisms → cellular organisms → Bacteria → Proteobacteria3223Open in IMG/M
3300006845|Ga0075421_101787202All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006845|Ga0075421_102380125All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300006847|Ga0075431_100356969All Organisms → cellular organisms → Bacteria → Proteobacteria1469Open in IMG/M
3300006876|Ga0079217_10349604All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300006894|Ga0079215_10760525Not Available668Open in IMG/M
3300006894|Ga0079215_11547816All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300006918|Ga0079216_10374983All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300006969|Ga0075419_10184225All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300007004|Ga0079218_10282127All Organisms → cellular organisms → Bacteria → Proteobacteria1335Open in IMG/M
3300007004|Ga0079218_10610279All Organisms → cellular organisms → Bacteria → Proteobacteria998Open in IMG/M
3300007004|Ga0079218_12756395All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300009147|Ga0114129_12034119All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300009156|Ga0111538_10036193All Organisms → cellular organisms → Bacteria → Proteobacteria6381Open in IMG/M
3300009162|Ga0075423_11665514All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300009174|Ga0105241_12262320Not Available540Open in IMG/M
3300010362|Ga0126377_10717656All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300010397|Ga0134124_11816451Not Available644Open in IMG/M
3300010397|Ga0134124_12717045Not Available538Open in IMG/M
3300011107|Ga0151490_1842320All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300012916|Ga0157310_10162937All Organisms → cellular organisms → Bacteria → Proteobacteria781Open in IMG/M
3300018422|Ga0190265_10463979All Organisms → cellular organisms → Bacteria → Proteobacteria1374Open in IMG/M
3300018422|Ga0190265_11366263All Organisms → cellular organisms → Bacteria → Proteobacteria824Open in IMG/M
3300018429|Ga0190272_10415257All Organisms → cellular organisms → Bacteria → Proteobacteria1105Open in IMG/M
3300018476|Ga0190274_10181805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1823Open in IMG/M
3300019360|Ga0187894_10056424All Organisms → cellular organisms → Bacteria2270Open in IMG/M
3300019361|Ga0173482_10342397Not Available674Open in IMG/M
3300022880|Ga0247792_1010104All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300025893|Ga0207682_10267486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927798Open in IMG/M
3300025901|Ga0207688_10214109All Organisms → cellular organisms → Bacteria → Proteobacteria1159Open in IMG/M
3300025901|Ga0207688_10768226Not Available610Open in IMG/M
3300025912|Ga0207707_10322777All Organisms → cellular organisms → Bacteria → Proteobacteria1333Open in IMG/M
3300025930|Ga0207701_10380915All Organisms → cellular organisms → Bacteria → Proteobacteria1217Open in IMG/M
3300025938|Ga0207704_10494232All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300025945|Ga0207679_10229933All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300026023|Ga0207677_11986041Not Available541Open in IMG/M
3300026067|Ga0207678_10587906All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300026089|Ga0207648_10607540All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300026095|Ga0207676_10025736All Organisms → cellular organisms → Bacteria → Proteobacteria4368Open in IMG/M
3300026116|Ga0207674_10125566All Organisms → cellular organisms → Bacteria → Proteobacteria2532Open in IMG/M
3300027873|Ga0209814_10141787All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300027880|Ga0209481_10091029All Organisms → cellular organisms → Bacteria → Proteobacteria1464Open in IMG/M
3300027886|Ga0209486_10336713All Organisms → cellular organisms → Bacteria → Proteobacteria899Open in IMG/M
3300027909|Ga0209382_10630910All Organisms → cellular organisms → Bacteria → Proteobacteria1162Open in IMG/M
3300027909|Ga0209382_11106366All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300028380|Ga0268265_10249610All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300028608|Ga0247819_10892520All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300031184|Ga0307499_10174507Not Available646Open in IMG/M
3300031228|Ga0299914_11215110Not Available603Open in IMG/M
3300031538|Ga0310888_10820385Not Available577Open in IMG/M
3300031547|Ga0310887_10452277All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300031548|Ga0307408_100027365All Organisms → cellular organisms → Bacteria → Proteobacteria3928Open in IMG/M
3300031548|Ga0307408_100300949All Organisms → cellular organisms → Bacteria → Proteobacteria1343Open in IMG/M
3300031548|Ga0307408_100644491All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300031548|Ga0307408_101551499Not Available628Open in IMG/M
3300031562|Ga0310886_11074233Not Available518Open in IMG/M
3300031824|Ga0307413_11011216All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300031858|Ga0310892_10165419All Organisms → cellular organisms → Bacteria → Proteobacteria1298Open in IMG/M
3300031892|Ga0310893_10320520All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300031901|Ga0307406_10706854All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031908|Ga0310900_10399419All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300031908|Ga0310900_11558576Not Available558Open in IMG/M
3300031940|Ga0310901_10038181All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300031940|Ga0310901_10188045All Organisms → cellular organisms → Bacteria → Proteobacteria816Open in IMG/M
3300031943|Ga0310885_10407455All Organisms → cellular organisms → Bacteria → Proteobacteria725Open in IMG/M
3300031995|Ga0307409_102918206Not Available505Open in IMG/M
3300032003|Ga0310897_10027027All Organisms → cellular organisms → Bacteria1901Open in IMG/M
3300032005|Ga0307411_10966115All Organisms → cellular organisms → Bacteria → Proteobacteria761Open in IMG/M
3300032017|Ga0310899_10377708All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300032126|Ga0307415_100273853All Organisms → cellular organisms → Bacteria → Proteobacteria1384Open in IMG/M
3300032211|Ga0310896_10017853All Organisms → cellular organisms → Bacteria2459Open in IMG/M
3300033412|Ga0310810_10509434All Organisms → cellular organisms → Bacteria → Proteobacteria1193Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere17.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.73%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.27%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.73%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.82%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_002165402088090015SoilMNKPTDSFSLRSVVEKVFAGFAAAAIIAFVSAGAVAMCFPNIA
GPICI_000751602088090015SoilMNKHTDSLSLRTVVEKVFVGFAAAAIVAFVSLGTVAICFPTVVA
GPICI_017899702088090015SoilMNQHTDSLSLRTVVEKVFVGFAAAAIVAFVSAGTVAICFPTVVA
MBSR1b_0836.000070502162886012Miscanthus RhizosphereMNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA
INPhiseqgaiiFebDRAFT_10081258223300000364SoilMNRPTDSLSLRHVVEKVFAGCAAVVIIAFVAAGTVAMCFPNIA*
JGI11643J12802_1022965023300000890SoilMNRHNDSYSLRAVVEKVFAGIAATAIIAFVSVGTVAMCFPTVA*
JGI11643J12802_1054989413300000890SoilMNRPHDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPTVA*
JGI10216J12902_10927711913300000956SoilMNKPTDSYSLRNVVEKVFAGFAAAAILAFVSAGTVAMCFPNIA*
F14TB_10025368023300001431SoilMNKYTDSFSLRTVVEKAFAGVAAAVILAFVSAGTVAMCFPNIVA*
soilL2_1008616543300003319Sugarcane Root And Bulk SoilMNRPNDSFSFRTVVEKVFAGIAAAAIIGFISAGTVAICFPPVA*
Ga0062593_10037031223300004114SoilMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA*
Ga0062593_10084373423300004114SoilMNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA*
Ga0062590_10098661923300004157SoilMNQHTDSLSLRTVVEKVFVGFAAAAIVAFVSAGTVAICFPTV
Ga0063356_10005881433300004463Arabidopsis Thaliana RhizosphereMNQHTDSLSLRTVVEKVFVGFAAAAIVAFVSAGTVAICFPTVVA*
Ga0063356_10185670223300004463Arabidopsis Thaliana RhizosphereMDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNLA*
Ga0063356_10419824923300004463Arabidopsis Thaliana RhizosphereMNKHTDSLSLRTVVEKVFVGFAAAVIVVFVSVGTVAMCFPTLVA*
Ga0063356_10633316813300004463Arabidopsis Thaliana RhizosphereMNRPNDSFSLRTVVEKVLAGIAAAAIIGFISAGTLAMCFSTVA*
Ga0066388_10379800723300005332Tropical Forest SoilMNKHNDSYSLRSVVEKVFAGIAAAVIITFISAGTLAMCFPNIA*
Ga0066388_10449924023300005332Tropical Forest SoilMNRHNDSYSLRTVVEKVFAGVAAAVIIAFVSAGTVAMCFPTLA*
Ga0070680_10017421813300005336Corn RhizosphereEETHMNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA*
Ga0070692_1002353233300005345Corn, Switchgrass And Miscanthus RhizosphereMNKPTDSYSLRSVVEKVFASFAAAAILAFVSAGTVAMCFPNVA*
Ga0070701_1110722123300005438Corn, Switchgrass And Miscanthus RhizosphereMNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA*
Ga0070694_10024281723300005444Corn, Switchgrass And Miscanthus RhizosphereMNRPHDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA*
Ga0070694_10041456113300005444Corn, Switchgrass And Miscanthus RhizosphereNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA*
Ga0070681_1141928413300005458Corn RhizosphereMNKPTDSFSLRSVVEKVFAGFAAAAIIAFVSAGAVAMCFPNIA*
Ga0068867_10049561713300005459Miscanthus RhizosphereNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA*
Ga0070665_10170132923300005548Switchgrass RhizosphereMNKHTDSLSLRTVVEKVFVGFAAAAIVAFVSIGTVAMCFPTVVA*
Ga0070664_10026218313300005564Corn RhizosphereHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA*
Ga0070664_10125361223300005564Corn RhizosphereMNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCF
Ga0068856_10261620313300005614Corn RhizosphereLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA*
Ga0068863_10110117113300005841Switchgrass RhizosphereMNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA*
Ga0075417_1019781123300006049Populus RhizosphereMNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAMCFPTVA*
Ga0075432_1023340413300006058Populus RhizosphereHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLVMCFPTVA*
Ga0075428_10002452053300006844Populus RhizosphereMNKPTDSFALRTVVEKVFAGIAAAMIIGFVSAGTVAMCFPNIA*
Ga0075428_10002877843300006844Populus RhizosphereMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPTVA*
Ga0075428_10012055043300006844Populus RhizosphereMNKHTDNLSIRAIGEKVFAGIAATAIIAFISLGTVAMCFPNVA*
Ga0075428_10176110223300006844Populus RhizosphereMNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAMC
Ga0075428_10190936223300006844Populus RhizosphereMNKHTDSLWLRTVVEKVFVGFAATAIVAFVSVGTVAMCIPTVVA*
Ga0075421_10012528933300006845Populus RhizosphereMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCLPTVA*
Ga0075421_10178720223300006845Populus RhizosphereMNKPTDNLSIRAVFEKVFAGIAATAIIAFISAGTVAMCFPNVA*
Ga0075421_10238012523300006845Populus RhizosphereMSKHTDSFSLRTVIEKAFAGVAAVVIIAFVSVGTLAMCFPTTIA*
Ga0075431_10035696933300006847Populus RhizosphereMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPSVA*
Ga0079217_1034960423300006876Agricultural SoilMDKHTDSFSFRCTIEKVFAGFAAAVIVAFVGAGTAVMCFPNLA*
Ga0079215_1076052513300006894Agricultural SoilMNKHTNSFSLRTAVEKVFAGFAAAVIIVFVSAGTAVMCFPTLA*
Ga0079215_1154781623300006894Agricultural SoilMDKHTDSFSFRSTIEKVFAGFAAAMIVAFVGAGTAVMCFPNLA*
Ga0079216_1037498323300006918Agricultural SoilMDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTVVMCFPNIA*
Ga0075419_1018422523300006969Populus RhizosphereMNKHTYSLWLRTVVEKVFVGFAATAIVAFVSVGTVAMCIPTVVA*
Ga0079218_1028212723300007004Agricultural SoilMDKHTDSLSFRSTIEKLFAGFAAAMIVAFVGAGTAVMCFPNLA*
Ga0079218_1061027923300007004Agricultural SoilMDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA*
Ga0079218_1275639523300007004Agricultural SoilMDKHTDSFSFRCTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA*
Ga0114129_1203411913300009147Populus RhizosphereMNKHTDNLSIRAIGEKVFAGIAATAIIAFISLGTVAM
Ga0111538_1003619383300009156Populus RhizosphereMNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAICFPTVA*
Ga0075423_1166551423300009162Populus RhizosphereMATDPRKTHMNKPNDSLSLRTVVEKVFAGFAAAVILTFISAGTVVMCFPN
Ga0105241_1226232023300009174Corn RhizosphereETHMNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA*
Ga0126377_1071765623300010362Tropical Forest SoilMNKPNDSLSLRSIVEKVFAGFAAAAIIAFVSAGTVAMCFPNVA*
Ga0134124_1181645123300010397Terrestrial SoilMANRSKEIQMSKHTDSLSLRNVVEKVFAGAAAAAIIVFVSAGTVAMCFPSIA*
Ga0134124_1271704513300010397Terrestrial SoilMNKPTDSHSLRSVVEKVFAGFAATAILAFVSAGTVAMCFPNVA*
Ga0151490_184232023300011107SoilLRSVVEKAFAGIAAAAIIAFVSAGTVAMCFPNVA*
Ga0157310_1016293723300012916SoilMNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCF
Ga0190265_1046397923300018422SoilMDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA
Ga0190265_1136626323300018422SoilMKKHTDSFSMRSVVEKVFAGFAAAVIFVFVSVGTAAMCFPNIA
Ga0190272_1041525723300018429SoilMDKHTDSFSFRSTIEKVFAGFAAAVIVAFVGAGTVVMCFPNIA
Ga0190274_1018180523300018476SoilMDKHTDSFSFRSTIEKVFAGFAATVIIAFIGAGTAVMCFPNIA
Ga0187894_1005642423300019360Microbial Mat On RocksMNKPTDSFSLRNMVEKVFAGFAAAVIVAFVGAGTAVMCFPNIA
Ga0173482_1034239723300019361SoilMNKPTDSHSLRSVVEKVFAGIAAAAIIVFVSAGTVAMCFPNVA
Ga0247792_101010423300022880SoilMNKPTDSYSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA
Ga0207682_1026748623300025893Miscanthus RhizosphereDGYRPEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA
Ga0207688_1021410913300025901Corn, Switchgrass And Miscanthus RhizosphereMNKPTDSHSLRSVVEKVFAGFAAAAILAFVSAGTVAMCFPNVA
Ga0207688_1076822623300025901Corn, Switchgrass And Miscanthus RhizosphereDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA
Ga0207707_1032277733300025912Corn RhizosphereMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA
Ga0207701_1038091513300025930Corn, Switchgrass And Miscanthus RhizosphereMNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVALSQDGAAE
Ga0207704_1049423213300025938Miscanthus RhizospherePDGYRPEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA
Ga0207679_1022993333300025945Corn RhizospherePEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFSTVA
Ga0207677_1198604113300026023Miscanthus RhizosphereTHMNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA
Ga0207678_1058790623300026067Corn RhizosphereMNKPTDSHSLRSVVEKVFASFAAAAILAFVSAGTVAMCFPNVA
Ga0207648_1060754023300026089Miscanthus RhizosphereMNKPTDSYSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA
Ga0207676_1002573673300026095Switchgrass RhizosphereKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA
Ga0207674_1012556633300026116Corn RhizosphereMNKPTDSYSLRSDIEKVFAGFAAAAILAFVSAGTVAMCFPNVA
Ga0209814_1014178723300027873Populus RhizosphereMNRPNDSLSLRALIEKVFAGVAAALIVAFVSVGTVAMCFPTVA
Ga0209481_1009102923300027880Populus RhizosphereMNKHTDNLSIRAIGEKVFAGIAATAIIAFISLGTVAMCFPNVA
Ga0209486_1033671323300027886Agricultural SoilMDKHTDSLSFRSTIEKLFAGFAAAMIVAFVGAGTAVMCFPNLA
Ga0209382_1063091013300027909Populus RhizosphereMSKHTDSFSLRTVIEKAFAGVAAVVIIAFVSVGTLAMCFPTTIA
Ga0209382_1110636613300027909Populus RhizosphereMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCLPTVA
Ga0268265_1024961023300028380Switchgrass RhizosphereMNKHTDSLSLRTVVEKVFVGFAAAAIVAFVSIGTVAMCFPTVVA
Ga0247819_1089252023300028608SoilMNRPNDSFSLRTVVEKVFGGIAAAAIIGFISAGTLAMCFPTVA
Ga0307499_1017450723300031184SoilSLSLRAVVEKVFAGVAATAIIAFISAGTVAMCFPNVA
Ga0299914_1121511023300031228SoilMDKHTDSFSLRSTIEKVFAGFAAAVIVAFVGAGTAVMCFPNIA
Ga0310888_1082038513300031538SoilMNKPNDSHSLRSIVEKVFAGFAAAAIIALVSAGTVAMCFPNVA
Ga0310887_1045227713300031547SoilMNKPNDSYSLRSIVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA
Ga0307408_10002736513300031548RhizosphereMNKPTDSFSLRSVVEKVFAGFAAAAITAFVSAGTVAMCFPNIA
Ga0307408_10030094923300031548RhizosphereMDKHTDSFSFRSTIEKVFAGFAAAVIIAFVGAGTAVMCFPNIA
Ga0307408_10064449113300031548RhizosphereMNRPTDSYSLRSVVEKLFAGIAAVAILVFVSAGTVAMCFPNVA
Ga0307408_10155149913300031548RhizosphereMNRPNDSLSLRALIEKVFAGVAAAFIIAFVSVGTVAMCFPTVA
Ga0310886_1107423313300031562SoilRPEETHMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTVAMCFPTVA
Ga0307413_1101121623300031824RhizosphereMNKHTDSFSFRSTIEKVFAGFAAAVIIAFVGAGTAVMCFPNIA
Ga0310892_1016541923300031858SoilMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTLAMCFPTVA
Ga0310893_1032052013300031892SoilSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPNVA
Ga0307406_1070685413300031901RhizosphereTDSFSFRSTIEKVFAGFAAAVIIAFVGAGTAVMCFPNIA
Ga0310900_1039941923300031908SoilSLRSIVEKVFAGFAAAAILAFVSAGTVAMCFPNVA
Ga0310900_1155857613300031908SoilMNKPTDSHSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA
Ga0310901_1003818123300031940SoilMNKPTDSYSLRSVIEKVFAGFAAAAILAFVSAGTVAMCFPTVA
Ga0310901_1018804513300031940SoilMNKPNDSHSLRSIVEKVFAGFAAAAIIAFVSAGTVAMCFPNVA
Ga0310885_1040745513300031943SoilMNRPNDSFSLRTVVEKVFAGIAAAAIIGFISAGTVAMCFPNVA
Ga0307409_10291820623300031995RhizosphereTHMNRPTDSYSLRSVVEKLFAGIAAVAILVFVSAGTVAMCFPNVA
Ga0310897_1002702723300032003SoilMNKPTDSYSLRSVIEKVFAGFAAAAIIALVSAGTVAMCFPNVA
Ga0307411_1096611523300032005RhizosphereMDKHTDSFSFRSTIEKVFAGFAAAVIIAVVGAGTAVMCFPNIA
Ga0310899_1037770823300032017SoilMNKPNDSLSLRTVVEKVFAGFAAAVILTFISAGTVVMCFPNVA
Ga0307415_10027385323300032126RhizosphereMNKHTDSFSFRSTIEKVFAGFAATVIIAFVGAGTAVMCFPNIA
Ga0310896_1001785313300032211SoilDSHSLRSIVEKVFAGFAAAAIIALVSAGTVAMCFPNVA
Ga0310810_1050943423300033412SoilMNQPTDSNSLRSVVEKVFAGIAAAAIIAFVSAGTVAMCFPNVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.