| Basic Information | |
|---|---|
| Family ID | F087910 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 48 residues |
| Representative Sequence | EAVEDEAPALTPEEEAGIEAALESYRQGRVVDAKRAREIIDAALGR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.27 % |
| % of genes near scaffold ends (potentially truncated) | 79.09 % |
| % of genes from short scaffolds (< 2000 bps) | 94.55 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF05016 | ParE_toxin | 38.18 |
| PF13443 | HTH_26 | 2.73 |
| PF12840 | HTH_20 | 1.82 |
| PF12704 | MacB_PCD | 1.82 |
| PF03450 | CO_deh_flav_C | 1.82 |
| PF13365 | Trypsin_2 | 0.91 |
| PF01863 | YgjP-like | 0.91 |
| PF06863 | DUF1254 | 0.91 |
| PF05569 | Peptidase_M56 | 0.91 |
| PF02738 | MoCoBD_1 | 0.91 |
| PF13751 | DDE_Tnp_1_6 | 0.91 |
| PF07819 | PGAP1 | 0.91 |
| PF06964 | Alpha-L-AF_C | 0.91 |
| PF00158 | Sigma54_activat | 0.91 |
| PF03965 | Penicillinase_R | 0.91 |
| PF00144 | Beta-lactamase | 0.91 |
| PF02780 | Transketolase_C | 0.91 |
| PF08818 | DUF1801 | 0.91 |
| PF00027 | cNMP_binding | 0.91 |
| PF14022 | DUF4238 | 0.91 |
| PF01436 | NHL | 0.91 |
| PF01925 | TauE | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.91 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.91 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.91 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.91 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.91 |
| COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.91 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.91 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.91 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.91 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.91 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.91 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.82 % |
| Unclassified | root | N/A | 8.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000881|JGI10215J12807_1003340 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300000891|JGI10214J12806_11952072 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300000956|JGI10216J12902_121011926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300001431|F14TB_106510328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 791 | Open in IMG/M |
| 3300003203|JGI25406J46586_10133596 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300004463|Ga0063356_100309903 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300004463|Ga0063356_104345093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300004779|Ga0062380_10026077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
| 3300005172|Ga0066683_10144561 | Not Available | 1458 | Open in IMG/M |
| 3300005174|Ga0066680_10556956 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005175|Ga0066673_10210646 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300005290|Ga0065712_10534373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300005332|Ga0066388_105085234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300005447|Ga0066689_10089298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1746 | Open in IMG/M |
| 3300005518|Ga0070699_100537708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300005540|Ga0066697_10528365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300005545|Ga0070695_101169041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300005549|Ga0070704_102224447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005553|Ga0066695_10621150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300005556|Ga0066707_10463552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300005566|Ga0066693_10194567 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005568|Ga0066703_10232863 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300005834|Ga0068851_10282099 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005842|Ga0068858_100384483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300005843|Ga0068860_100743962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300005937|Ga0081455_10046032 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300006638|Ga0075522_10124680 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300006797|Ga0066659_10703346 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006797|Ga0066659_11679761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300006894|Ga0079215_10937729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300006903|Ga0075426_10964457 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006954|Ga0079219_12180504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009012|Ga0066710_100196874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2864 | Open in IMG/M |
| 3300009012|Ga0066710_101108632 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300009032|Ga0105048_11053805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300009137|Ga0066709_101916872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 824 | Open in IMG/M |
| 3300009147|Ga0114129_10794940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300009171|Ga0105101_10280265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300009540|Ga0073899_10837232 | Not Available | 654 | Open in IMG/M |
| 3300010301|Ga0134070_10158376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300010359|Ga0126376_10573586 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300011120|Ga0150983_12667169 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300011269|Ga0137392_11197618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300011422|Ga0137425_1075424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300011443|Ga0137457_1044552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
| 3300012096|Ga0137389_11419744 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012146|Ga0137322_1038226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300012208|Ga0137376_11437809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012212|Ga0150985_101589650 | Not Available | 798 | Open in IMG/M |
| 3300012228|Ga0137459_1203993 | Not Available | 577 | Open in IMG/M |
| 3300012680|Ga0136612_10391028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012922|Ga0137394_11215859 | Not Available | 617 | Open in IMG/M |
| 3300012976|Ga0134076_10386199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300013500|Ga0120195_1031549 | Not Available | 535 | Open in IMG/M |
| 3300014157|Ga0134078_10238931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300014745|Ga0157377_10827528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300015052|Ga0137411_1075892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300015200|Ga0173480_10236093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300015245|Ga0137409_10201827 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300015360|Ga0163144_11460448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300015360|Ga0163144_11590425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300015372|Ga0132256_103877354 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300015373|Ga0132257_101983199 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300017657|Ga0134074_1291581 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300018000|Ga0184604_10202034 | Not Available | 681 | Open in IMG/M |
| 3300018028|Ga0184608_10225860 | Not Available | 822 | Open in IMG/M |
| 3300018031|Ga0184634_10215546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300018056|Ga0184623_10154152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1062 | Open in IMG/M |
| 3300018079|Ga0184627_10453412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300018422|Ga0190265_12629412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300018466|Ga0190268_11611191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300018468|Ga0066662_10054434 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
| 3300018476|Ga0190274_10384908 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300018481|Ga0190271_13730050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300019458|Ga0187892_10000064 | All Organisms → cellular organisms → Bacteria | 232721 | Open in IMG/M |
| 3300019487|Ga0187893_10305360 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300020015|Ga0193734_1070026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300021081|Ga0210379_10520682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300022549|Ga0212091_10427001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300025149|Ga0209827_10318113 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300025318|Ga0209519_10168094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10 | 1296 | Open in IMG/M |
| 3300025917|Ga0207660_11115632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300025926|Ga0207659_11421300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300026035|Ga0207703_11955314 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026089|Ga0207648_11641017 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300026089|Ga0207648_11817300 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026318|Ga0209471_1048805 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300026318|Ga0209471_1130252 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026538|Ga0209056_10139848 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300026538|Ga0209056_10688712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300027324|Ga0209845_1025302 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300027831|Ga0209797_10033383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2328 | Open in IMG/M |
| 3300027875|Ga0209283_10244689 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300027878|Ga0209181_10801919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300027882|Ga0209590_10676265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300028380|Ga0268265_11978763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300028381|Ga0268264_10776706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300028381|Ga0268264_12026926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300030570|Ga0247647_1117175 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031229|Ga0299913_11268298 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031538|Ga0310888_10654703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300031740|Ga0307468_100505676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300031944|Ga0310884_10342139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300031944|Ga0310884_10818902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300031949|Ga0214473_10657278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300032157|Ga0315912_11168025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300032163|Ga0315281_10016688 | All Organisms → cellular organisms → Bacteria | 9782 | Open in IMG/M |
| 3300032163|Ga0315281_12166319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300033407|Ga0214472_10305412 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300034177|Ga0364932_0236079 | Not Available | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.82% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.82% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.91% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.91% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.91% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.91% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.91% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10215J12807_10033402 | 3300000881 | Soil | AVEDEAPALSPEEEAGIEAALESYRQGRVIDARRAREIIDAALGR* |
| JGI10214J12806_119520721 | 3300000891 | Soil | ELPAGRYVVEAVEDEAPALSPEEEAGIEAALESYRQGRVIDARRAREIIDAALGR* |
| JGI10216J12902_1210119261 | 3300000956 | Soil | GRYVVEAVEDEAAALTPEEDAGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| F14TB_1065103281 | 3300001431 | Soil | EEAPVLTPEEEAAGIEAALESYRQGRVVHAKRARQIIHAALRR* |
| JGI25406J46586_101335961 | 3300003203 | Tabebuia Heterophylla Rhizosphere | GRYVVEAVEDEAPALTPEEEAGIEAALESYRQGRVVDSKRAREIIDAALGR* |
| Ga0063356_1003099031 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PALSLDEEAGIEAALESYRQGHVVDAKRAREIIDAALGR* |
| Ga0063356_1043450932 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DPAGRYVIEAVEDEAPALTPEEEAGIVAALESYRQGRVIDSKRAREIIDAALGR* |
| Ga0062380_100260771 | 3300004779 | Wetland Sediment | MRELPAGRYVVESVDLEAPPLSSEEEAGIEVALESYRQGRTVDAKRAREIINATLGR* |
| Ga0066683_101445613 | 3300005172 | Soil | EAVDEEAPALSPDEEAGIEAALESYRQGRVVDAKRARQIIDAALGR* |
| Ga0066680_105569561 | 3300005174 | Soil | VIQAVEDEAPALSAEEEAGIEGALELYRQGRVVAAKHAGKIIDAALDR* |
| Ga0066673_102106461 | 3300005175 | Soil | APALTPEEEAGIEAALESYRQGRVVDSKRAREIIDAALGR* |
| Ga0065712_105343731 | 3300005290 | Miscanthus Rhizosphere | EAVEDEAPALTPEEEAGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| Ga0066388_1050852343 | 3300005332 | Tropical Forest Soil | PAGRYVVEAVEDEAPALTPEEEAGIEAALESYRQGRVVDSKRAREIIDAALGR* |
| Ga0066689_100892984 | 3300005447 | Soil | EEEAPVLSPEEEAGIEAALESYRQGRVVNAKRAREIIDAALGR* |
| Ga0070699_1005377081 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAVEEEAPVLTQDEEAGIEAALESYRQGRVVDAKRARQIIDVALGR* |
| Ga0066697_105283651 | 3300005540 | Soil | ALSPDEEAGIEAALESYRQGRIVDAKRARQIIDAALGR* |
| Ga0070695_1011690412 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GRYVVEAVEEEAPVLTQDEEAGIEAALESYRQGRVVDAKRARQIIDVALGR* |
| Ga0070704_1022244472 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DEAPALSPDEDAGIEAALESYRQGRTVDAKHARQIIDAALGR* |
| Ga0066695_106211501 | 3300005553 | Soil | ELRDLPAGRYVVEAIEEEAPVLSPEEEAGIEAALESYRQGRVVNAKRAREIIDAALGR* |
| Ga0066707_104635521 | 3300005556 | Soil | EAPVLSPEEEAGIEAALESYRQGRVVNAKRAREIIDAALGR* |
| Ga0066693_101945672 | 3300005566 | Soil | VIEDEAPPLSPEEEAGIEAALESYRQGRIVDAKRAREIIDAALWR* |
| Ga0066703_102328633 | 3300005568 | Soil | VEAVEEEAPVLLPDEEAGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| Ga0068851_102820992 | 3300005834 | Corn Rhizosphere | LEESRLSTYSLTAGRYVIEAVDEEAPALSADEEAGIEAALESYHQGRVVDVKRARQIIDAALGR* |
| Ga0068858_1003844831 | 3300005842 | Switchgrass Rhizosphere | EEEAGIEAALESYRQGRVIDSKRAREIIDAALGR* |
| Ga0068860_1007439621 | 3300005843 | Switchgrass Rhizosphere | RELPAGRYVVEAVDEEAPALSPEEETGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| Ga0081455_100460324 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LTPEEEAGIEAALESYRQGRVVDSKRTREIIDAALGR* |
| Ga0075522_101246805 | 3300006638 | Arctic Peat Soil | LSPDEEAGIDAALESYRQGRVVDAKRAREIIDTALGR* |
| Ga0066659_107033463 | 3300006797 | Soil | LVEQVDEQAPTVTLNEDAGIEEALESYGQGRVVDAKRARAIIDAVLGR* |
| Ga0066659_116797612 | 3300006797 | Soil | PAELRELPAGRYVVEAIDDDAPALSSDEEAGIEAALESYRQGRIVDAKRARQIIDAALGR |
| Ga0079215_109377291 | 3300006894 | Agricultural Soil | ELPAGRYVIEPVDEEAPALSPEEEAGSEAALESYRQGRVVDAQRAREIIDAALGR* |
| Ga0075426_109644571 | 3300006903 | Populus Rhizosphere | SPEEEAGIEAAVESFRQGRVVDAKRAREIIDAAR* |
| Ga0079219_121805041 | 3300006954 | Agricultural Soil | LSPDEEAGIEAVLESYLQGRVVDADRAREIIHAALGR* |
| Ga0066710_1001968741 | 3300009012 | Grasslands Soil | EDEAPALTPEEEAGIEAALESYRQGRVVDSKRTREIIDAALGR |
| Ga0066710_1011086322 | 3300009012 | Grasslands Soil | VLTPDEEAGIAAALESCRQGRVVDAKRTRAIIDAALGR |
| Ga0105048_110538051 | 3300009032 | Freshwater | PPLTAEEDAGIEAALESYRQGRVVDATRARAIIDAALKR* |
| Ga0066709_1019168721 | 3300009137 | Grasslands Soil | VPPEVRDLPAGRYIVEAVEDEAPALSPDEEGGIETALESYRQGCVVDAKHARQIIDAALGR* |
| Ga0114129_107949402 | 3300009147 | Populus Rhizosphere | VFFWTSEIAAGIEAALASYRQGRVVDAKRAREIIDAALGR* |
| Ga0105101_102802653 | 3300009171 | Freshwater Sediment | RELPAGRYVVEAVEDEAPALSPEEEAGIEAALESYRQGRVVDAKRARHIIDAALGR* |
| Ga0073899_108372323 | 3300009540 | Activated Sludge | EQELTAEDEAGIEAALESYEQGRTMTQEQARALIDAALRP* |
| Ga0134070_101583761 | 3300010301 | Grasslands Soil | PTLTPDEEAGIEAALESYRQGRVVDARRARQIIDAALGR* |
| Ga0126376_105735863 | 3300010359 | Tropical Forest Soil | MEAVEDEAPALTLEEEAGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| Ga0150983_126671692 | 3300011120 | Forest Soil | LPAGRYVLEALDSEAPDLSADEEAGIDTTLESYRQGRVVDAKRAREIIDAALGR* |
| Ga0137392_111976182 | 3300011269 | Vadose Zone Soil | ELPAGRYVVEAVDEEAPALSPDEEAGIEAALESYRQGRVVDAKRARQIIDAALGR* |
| Ga0137425_10754242 | 3300011422 | Soil | RELPAGRYVIEAIDDAPALSAHEEAGLDAALESYRQGRVVDARRARQIIDAALGR* |
| Ga0137457_10445521 | 3300011443 | Soil | DEAPALSPEDEAGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| Ga0137389_114197442 | 3300012096 | Vadose Zone Soil | LPAGRYVVEALEDEAPALSPEEDTGIETALESHRQGRIVDARRARTIIDAALER* |
| Ga0137322_10382261 | 3300012146 | Soil | DLPAGRYVVEAVDEEAPALSPEEEAGIEVALESYRQGRVVDAKRAREIIDTALGR* |
| Ga0137376_114378091 | 3300012208 | Vadose Zone Soil | DDEAPTLSPEEEAGIEVALESYRQGRVIDAKHAREIIDAALGR* |
| Ga0150985_1015896503 | 3300012212 | Avena Fatua Rhizosphere | LPAGRYVVEAVDDDAPVLSPEEEAGIETALESYRQGRVVDAKRARQIIDAALGR* |
| Ga0137459_12039931 | 3300012228 | Soil | AVQDEAPALSPEEESGIEAALESYRQGGAAEAKRAREIIDAALER* |
| Ga0136612_103910281 | 3300012680 | Polar Desert Sand | VEAIEDDAPALSADEEAGIEAALESYRQGRVVDAKRTRQIIDAALGH* |
| Ga0137394_112158593 | 3300012922 | Vadose Zone Soil | DEEAGIEAALESYRQGRVVDAKRAREIIDAALGR* |
| Ga0134076_103861993 | 3300012976 | Grasslands Soil | SPDEEAGIEAALESYRQGRIVDAKRARQIIDAALGR* |
| Ga0120195_10315491 | 3300013500 | Terrestrial | EEEAGIEAALESYRAGRAVDAKRAREIIDAALGR* |
| Ga0134078_102389313 | 3300014157 | Grasslands Soil | LTPDEEAGIEAALESYRQGRVVDARRARQIIDAALGR* |
| Ga0157377_108275282 | 3300014745 | Miscanthus Rhizosphere | EAVEDEAPALTPEEEAGIEAALESYRQGRVVDSKRAREIIDAALGR* |
| Ga0137411_10758922 | 3300015052 | Vadose Zone Soil | DEEAGIEAALESYRQGRIVDAKRARQIIDAALGR* |
| Ga0173480_102360932 | 3300015200 | Soil | DEEAGIEAALESYRKGRVVDSKRAREIIDAALGR* |
| Ga0137409_102018274 | 3300015245 | Vadose Zone Soil | EAVEEEAPVLTQDEEAGIEAALESYRQGRVVDAKRARQIIDVALGR* |
| Ga0163144_114604483 | 3300015360 | Freshwater Microbial Mat | AGRYVVEAVDDEAPALSPDEEAGIEAALESYRQGRVVDATRSRQIIDAAFGR* |
| Ga0163144_115904251 | 3300015360 | Freshwater Microbial Mat | AGRYVVEAVDDEAPALSPDEEAGIEAALESYRQGRVVDATRARQIIDAAFGR* |
| Ga0132256_1038773541 | 3300015372 | Arabidopsis Rhizosphere | PEGRYVVEAVEDEAPALTPEEEAGIEAALESYRQGQVVDSKRAREIIDAAPGR* |
| Ga0132257_1019831992 | 3300015373 | Arabidopsis Rhizosphere | LLELPAGRYVVESVEEEPPVLTPEEEHGIEAALEPYRQGSIIDGKRAREIIDIASRR* |
| Ga0134074_12915811 | 3300017657 | Grasslands Soil | LVEQIDEQAPTVTLNEDAGIEEALESYGQGRVVDAKHARAIIDAVLGR |
| Ga0184604_102020341 | 3300018000 | Groundwater Sediment | FVVEVVEDEVPALSPEEEAGIEAAFESYRQGRVVDAKPAREIIDATLGR |
| Ga0184608_102258603 | 3300018028 | Groundwater Sediment | EDEVPVLSPEEEAGIEAALESCREGRVVDAKPAREIIDATLGR |
| Ga0184634_102155462 | 3300018031 | Groundwater Sediment | VLSPEEEAGIEAALESYRQGRVVDAKRAREIIDAALGR |
| Ga0184623_101541522 | 3300018056 | Groundwater Sediment | LEEEAPTLSPEEEAGIETALESCRQGRVVDAKRVREIIDAALGR |
| Ga0184627_104534122 | 3300018079 | Groundwater Sediment | AVEENAPILSPDEEAGVEAAFESYRQGRVVDAKRAREIIDAALRR |
| Ga0190265_126294121 | 3300018422 | Soil | MAPALSPEEDAGTEAALESYRQGRVVDARRAREIIDAALER |
| Ga0190268_116111911 | 3300018466 | Soil | EGTTLSPEEEAGIEAALESYRQGRIVDAKRAREIIDAALGR |
| Ga0066662_100544341 | 3300018468 | Grasslands Soil | VESVDDEAPTLSPEEEAGIEVALESYRQGRVIDAKRAREIIDAALGR |
| Ga0190274_103849082 | 3300018476 | Soil | VGRYVVEAVEDEAQALTPEEEAGIEAALESYRQGRVVDSKRAREIIDAALGR |
| Ga0190271_137300501 | 3300018481 | Soil | VEAVDEEAPALSPEEEVGIEAALESYRMGRVVDAKRAREIIDAALGR |
| Ga0187892_1000006441 | 3300019458 | Bio-Ooze | VPAELRELPAGRYLVEAVEDDAPRLTSDEEVGIDAALESYRQGRVVDAGRAREIINAALG |
| Ga0187893_103053601 | 3300019487 | Microbial Mat On Rocks | AVEDEAPALSPEEEAGIEAALESYRQGRVVDSRRAREIIDAALGR |
| Ga0193734_10700263 | 3300020015 | Soil | AELRELPAGRYVVEAVDEEAPALSPDEEAGIEAALESYRQGRVVDAKRAREIIDTALGR |
| Ga0210379_105206822 | 3300021081 | Groundwater Sediment | VVEAIDDDAPSLSPDEEAGIEAALESYRQGRVVDAKRARQIIDAALGH |
| Ga0212091_104270012 | 3300022549 | Groundwater | AIDDHAPSLSPDEEAGIEAALESYRQGRVVDAKRARQIIDAALGR |
| Ga0209827_103181131 | 3300025149 | Thermal Springs | YVVEAVDDELRSLSSEEEAGIEVALESYRQGHVVDAKRAREIINAASGR |
| Ga0209519_101680943 | 3300025318 | Soil | PAGRYVLEAVDDEAPALSPDEEAGIEAALESYRQGRVVDAKRARQIIDAALGR |
| Ga0207660_111156321 | 3300025917 | Corn Rhizosphere | VVEAVEDEAPALSPEEEAGIEAALESYRHGRVVDAKRAREIIDAALGR |
| Ga0207659_114213001 | 3300025926 | Miscanthus Rhizosphere | PEEEAGIEAALESYRQGRVIDSKRAREIIDAALGR |
| Ga0207703_119553142 | 3300026035 | Switchgrass Rhizosphere | LEESRLSTYSLTAGRYVIEAVDEEAPALSADDEAGIEAALESYHQGRVVDVKRARQIIDAALGR |
| Ga0207648_116410172 | 3300026089 | Miscanthus Rhizosphere | VGRYVVEAVDDEAPALTPEEEAVIEAALESYRQGRVVDSRRAREIIDAALDR |
| Ga0207648_118173001 | 3300026089 | Miscanthus Rhizosphere | VEAVEDEAPALTFEEEAGIEAALESYRQGRVVDSKRAREIIDAALGR |
| Ga0209471_10488054 | 3300026318 | Soil | VPPELRELPAGRYLVEAVEEEAPVLLPDEEARIEAALESYRQGRVVDAKRAREIIDAALG |
| Ga0209471_11302522 | 3300026318 | Soil | LPAGRYVVEPVEDEAPALTPEEEAGIEAALESYRQGRIVDSKRAREIIDAALGR |
| Ga0209056_101398481 | 3300026538 | Soil | VIAKHQEVYHLPAGRYLVEQVDEQAPTVTLNEDAGIEEALESYGQGRVVDAKRARAIIDAVLGR |
| Ga0209056_106887122 | 3300026538 | Soil | SPEEEAGIEAALESYRQGRVVDAKRARQIIDAALGR |
| Ga0209845_10253022 | 3300027324 | Groundwater Sand | RYVVEPVEEAPVLTPEEEAGTDEALESYRQGRVVYAKRARAIIDAALGR |
| Ga0209797_100333831 | 3300027831 | Wetland Sediment | MRELPAGRYVVESVDLEAPPLSSEEEAGIEVALESYRQGRTVDAKRAREIINATLGR |
| Ga0209283_102446893 | 3300027875 | Vadose Zone Soil | PELRELPAGRYVVEPLDEEAPSLSPDAEAGIEAALESYRQGRVVDAKRAREIIDAALRR |
| Ga0209181_108019191 | 3300027878 | Freshwater | PPLTAEEDAGIEAALESYRQGRVVDATRARAIIDAALKR |
| Ga0209590_106762651 | 3300027882 | Vadose Zone Soil | AELRELPAGRYVVEAVDDEAPGLSPDEEAGIEAALESYRQGRVVDSKRARQIIDTALGR |
| Ga0268265_119787631 | 3300028380 | Switchgrass Rhizosphere | VEAVEDDAPALTPEEEAGIEAALESYRQGRVIDSKRAREIIDAALGR |
| Ga0268264_107767063 | 3300028381 | Switchgrass Rhizosphere | LRELPAGRYVVEAVDEEAPALSPEEETGIEAALESYRQGRVVDAKRAREIIDAALGR |
| Ga0268264_120269263 | 3300028381 | Switchgrass Rhizosphere | HELRELPAGRYVVEAVEEKAPSLTPEEEAGIETALESYRQGRVVDAKRAREIIDAALGR |
| Ga0247647_11171752 | 3300030570 | Soil | VKEYADEAAALSPEEEAGIEAALESYRQGRVVDAKRAREIID |
| Ga0299913_112682981 | 3300031229 | Soil | SAEEEAGLEAALESYRQGRVVDARRTREIIDAALGR |
| Ga0310888_106547032 | 3300031538 | Soil | DDEAPALSPDEEAGIEAALESYRQGRVVDAKRAREIIDAALGR |
| Ga0307468_1005056763 | 3300031740 | Hardwood Forest Soil | VALSPAEEAGLEAALESYRQGRVVDAKRAREIIDAALGR |
| Ga0310884_103421393 | 3300031944 | Soil | LYVVEAVEDEAPALSPEEEAGIEAALESYRQGRVIDARRAREIIDAALGR |
| Ga0310884_108189022 | 3300031944 | Soil | ALSPEEEAGIEAALESYRQGRVVDAKRAREIIDAALGR |
| Ga0214473_106572783 | 3300031949 | Soil | DAPRLTSDEEAGIETALESYRQGRVVDADRAREIINAALGR |
| Ga0315912_111680251 | 3300032157 | Soil | PAEQRELPAGRYLVEAVEDEAPRLSADEEAGIEAALESYRQGRIVDAARAREIISAALGR |
| Ga0315281_100166883 | 3300032163 | Sediment | MVEAVDDEAPDLSVDKEAGVEAALESYRQGHVVDAKRARQIIDAALGG |
| Ga0315281_121663192 | 3300032163 | Sediment | PAEMRELPAGRYVVESVDLEAPPLSLEEDAGIEAALESYRQGRIVDAKRAREIIDATLGR |
| Ga0214472_103054122 | 3300033407 | Soil | VVEAVDDEVRSLLPEEGAGIEVALESYRQGHVVDAKRTREIIDAASGRENPPHWKRSP |
| Ga0364932_0236079_69_224 | 3300034177 | Sediment | VVATIEAVDDEAAALSPDEEAGIEAALESYRQGRIVDGKLARKIIDAALGR |
| ⦗Top⦘ |