NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087870

Metagenome / Metatranscriptome Family F087870

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087870
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 49 residues
Representative Sequence LGDRRGIETLLRNGQGQMPSVGKDWTDKQIDALVAYTKQFAKAGG
Number of Associated Samples 97
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 93.64 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.636 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.364 % of family members)
Environment Ontology (ENVO) Unclassified
(28.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.36%    β-sheet: 0.00%    Coil/Unstructured: 61.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00115COX1 96.36
PF02823ATP-synt_DE_N 0.91
PF01266DAO 0.91
PF01040UbiA 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.64 %
UnclassifiedrootN/A26.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig50031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
2170459005|F1BAP7Q02H4WX5All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300001534|A15PFW1_10363004All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300002568|C688J35102_117697768All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300002568|C688J35102_119697196All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300002568|C688J35102_120111887All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300004479|Ga0062595_100690631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300004800|Ga0058861_11754536All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005327|Ga0070658_10220226All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300005327|Ga0070658_10933812All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005332|Ga0066388_106991862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300005336|Ga0070680_100527032Not Available1012Open in IMG/M
3300005337|Ga0070682_100591138All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300005437|Ga0070710_11493804All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005439|Ga0070711_100780754All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005530|Ga0070679_100217683Not Available1872Open in IMG/M
3300005534|Ga0070735_10182576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1290Open in IMG/M
3300005535|Ga0070684_101126036All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005549|Ga0070704_102158987All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005577|Ga0068857_100059121All Organisms → cellular organisms → Bacteria3404Open in IMG/M
3300005577|Ga0068857_101102035All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005614|Ga0068856_101336473All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300005616|Ga0068852_101218712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300005949|Ga0066791_10113076All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300009545|Ga0105237_10674060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300009551|Ga0105238_11066214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300010152|Ga0126318_10494000All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300010152|Ga0126318_10696404All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010360|Ga0126372_10416543Not Available1232Open in IMG/M
3300010376|Ga0126381_104586112All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012019|Ga0120139_1198872All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012363|Ga0137390_11121760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300012493|Ga0157355_1007058All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300012515|Ga0157338_1062211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300012927|Ga0137416_10570572Not Available982Open in IMG/M
3300012957|Ga0164303_10980062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300012958|Ga0164299_10149333Not Available1291Open in IMG/M
3300012958|Ga0164299_11179541All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012960|Ga0164301_10366261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria996Open in IMG/M
3300012961|Ga0164302_10075754Not Available1774Open in IMG/M
3300012982|Ga0168317_1067752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300012987|Ga0164307_11616471All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300012988|Ga0164306_10424193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300012988|Ga0164306_10662388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300012988|Ga0164306_10789843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300012989|Ga0164305_10372684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300012989|Ga0164305_10802917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300013104|Ga0157370_11370200All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300013105|Ga0157369_11056921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300013501|Ga0120154_1141831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium543Open in IMG/M
3300014031|Ga0120173_1048709All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300014498|Ga0182019_10897131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300015357|Ga0134072_10210449All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300015373|Ga0132257_102079984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300016319|Ga0182033_10653422Not Available917Open in IMG/M
3300018073|Ga0184624_10155739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia pseudomultivorans1006Open in IMG/M
3300020077|Ga0206351_10191448All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300020610|Ga0154015_1360233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300021363|Ga0193699_10132911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300021968|Ga0193698_1053779All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300022467|Ga0224712_10222763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300024323|Ga0247666_1019910Not Available1441Open in IMG/M
3300025679|Ga0207933_1222075All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025703|Ga0208357_1073113Not Available1063Open in IMG/M
3300025912|Ga0207707_10083698All Organisms → cellular organisms → Bacteria2786Open in IMG/M
3300025912|Ga0207707_11286457All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300025916|Ga0207663_10345017Not Available1126Open in IMG/M
3300025921|Ga0207652_10139639Not Available2166Open in IMG/M
3300025925|Ga0207650_11922441All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025932|Ga0207690_10656889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300025934|Ga0207686_10132334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1712Open in IMG/M
3300025934|Ga0207686_10933357Not Available702Open in IMG/M
3300026041|Ga0207639_10487866Not Available1124Open in IMG/M
3300026078|Ga0207702_11530587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300026324|Ga0209470_1353393All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300027787|Ga0209074_10205389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300027908|Ga0209006_11330779All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300028710|Ga0307322_10155718All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300028755|Ga0307316_10076222Not Available1151Open in IMG/M
3300028782|Ga0307306_10187660All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300028792|Ga0307504_10249812All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300028800|Ga0265338_10727403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300028824|Ga0307310_10744817All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300030114|Ga0311333_10738539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300030114|Ga0311333_10896870All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300030294|Ga0311349_10416836All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300030838|Ga0311335_11260379All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300030997|Ga0073997_11264586All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031231|Ga0170824_125217911All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031247|Ga0265340_10559426All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031249|Ga0265339_10585147All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031251|Ga0265327_10142877Not Available1117Open in IMG/M
3300031548|Ga0307408_100451530Not Available1115Open in IMG/M
3300031549|Ga0318571_10126999Not Available861Open in IMG/M
3300031712|Ga0265342_10153611Not Available1276Open in IMG/M
3300031769|Ga0318526_10463427All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031821|Ga0318567_10819849All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031893|Ga0318536_10069919Not Available1725Open in IMG/M
3300031894|Ga0318522_10294046All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031938|Ga0308175_100794921Not Available1034Open in IMG/M
3300032066|Ga0318514_10134168Not Available1276Open in IMG/M
3300032126|Ga0307415_100582799Not Available992Open in IMG/M
3300032828|Ga0335080_10203077Not Available2179Open in IMG/M
3300032955|Ga0335076_10094031All Organisms → cellular organisms → Bacteria2928Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.18%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere6.36%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.73%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.91%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014031Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25MEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_007920802140918007SoilYVGPALAGNSLLGDRKGIETLLRTGRGLMPAVGKNWSSEQIDALIAWTKQYTKSSAK
E41_014233802170459005Grass SoilGIESLLRNGQGQMPPVGKNWTDHQIDALIAYTTQFAKKG
A15PFW1_1036300423300001534PermafrostRKAIEVLLRGGQGQMPSVGRDWTSRQLDSLIAYTKQFATKGSNG*
C688J35102_11769776823300002568SoilYIGPELGGNALLGDRKGLERLLRNGQGQMPPVGRDWTDHQIDALVSYTKQFAGGGKG*
C688J35102_11969719613300002568SoilADREGLETLVREGRGNMPAVGNTWTDDQIDALVAYTKRFATQGGGQSGGEG*
C688J35102_12011188713300002568SoilLGSRYIGPDLQGNPLLANRASIERLLRQGQGQMPAVGASWTDAQIDALVSYTKQFASKGGS*
Ga0062595_10069063123300004479SoilERTGIETLLRNGQGQMPAVGRTWSGSQIDALISYTKQFAKTGG*
Ga0058861_1175453623300004800Host-AssociatedIGGNPLLGDRRGIEVLLRHGQGQMPSVGKDWSDKQIDALVAYTKRYAKAGG*
Ga0070658_1022022623300005327Corn RhizosphereGPALSGNSLLGDRKGIETLLRNGRGQMPAVGKNWTGAQIDALIAWTKQYTKGGGK*
Ga0070658_1093381213300005327Corn RhizospherePALGGNSLLADRKGIETLLRNGRGQMPAVGKSWTGAQIDALISWTKQYAKAGGS*
Ga0066388_10699186223300005332Tropical Forest SoilALTVLLVNGRGQMPPVGRGWTRRQFVALVAYTKQFAKAGGG*
Ga0070680_10052703213300005336Corn RhizosphereLGDRRGIETLLRNGQGQMPSVGKDWTDKQIDALVAYTKQFAKAGG*
Ga0070682_10059113813300005337Corn RhizosphereAGNPLLGDAKGLSTLLRNGGTRMPAVGKNWTDAQIQALVSYTKQFSKQGGGG*
Ga0070710_1149380423300005437Corn, Switchgrass And Miscanthus RhizosphereLDHAYIGPALGGNPLLSDVNGLTTLLRNGQGQMPAVGRNWTNAQIEALVAYTKHLPKGGGS*
Ga0070711_10078075423300005439Corn, Switchgrass And Miscanthus RhizospherePALQGNALLGDRRGIETLLRNGRGNMPAVGNNWTDAQIDALISWTKRYASTGAAG*
Ga0070679_10021768323300005530Corn RhizosphereGPALNGNPLLGDRKGIETLLRNGGVQMPPVGRDWSGKQIDALVAYTKRFAKVGG*
Ga0070735_1018257623300005534Surface SoilRNGQGQMPAVGKNWTGAQIDALIAYTKQFTKAGS*
Ga0070684_10112603623300005535Corn RhizosphereDKKGLTTLLRNGQGQMPSVGKNWSDAQIDALVAYTKRYAKAGG*
Ga0070704_10215898713300005549Corn, Switchgrass And Miscanthus RhizospherePLGGNALLGNRQGIESLLREGRGMMPAVGKNWTDAQIDALISYTKQFTKSGGS*
Ga0068857_10005912153300005577Corn RhizosphereDRKGMETLLRKGGIQMPSVGRDWSDKQIDALVAYTKRFAAAGG*
Ga0068857_10110203523300005577Corn RhizosphereLDHPYIGPALAGNPLLGDAKGLSTLLRNGGTRMPAVGKNWTDAQIQALVSYTKQFSKQGGGG*
Ga0068856_10133647313300005614Corn RhizosphereCHRLDHKYVGPALGGNPLLGDVKGISALLRNGGIMMPAVGKNWTDAQIEALIAYTKQYAKAAS*
Ga0068852_10121871223300005616Corn RhizosphereDKKGLTTLLRSGQGQMPSVGKDWSDAQIDALVAYTKRYAKAGG*
Ga0066791_1011307623300005949SoilLTTILRNGQGAMPPVGKNWTDGQIQALVGYTKQFAKAGGS*
Ga0105237_1067406023300009545Corn RhizosphereTTLLRNGQGQMPSVGKNWSDAQIDALVAYTKRYAKAGG*
Ga0105238_1106621413300009551Corn RhizosphereNPLLGQVHSLTTLLRNGQGNMPAVGRNWSQHQIQALVAYTKQFAKQG*
Ga0126318_1049400023300010152SoilYIGPALGGNPLLHDRKGIEALLRKGQGQMPAVGRNWTPHQIDALVAYTKTLGSGS*
Ga0126318_1069640413300010152SoilGNSLLADRNGIETLLRNGRGQMPAVGFNWTGKQIDALISYTKRFAKGGNG*
Ga0126372_1041654313300010360Tropical Forest SoilKCHRLDKPFIGPALGGNPLLADPARITPLLRQGQGQMPAVGRNWTRAQIDALTSYTKQFAKAGG*
Ga0126381_10458611213300010376Tropical Forest SoilRLDHKYVGPALGGNALLGEKHGLETLLRNGRGLMPAVGKNWTDAQIDALLAWTKQYAKGGTGSGG*
Ga0105246_1165461413300011119Miscanthus RhizosphereKSIERLLRQGQGQMPAVGENWSSAQIDALVSYTKQFAQKGGS*
Ga0120139_119887213300012019PermafrostALGGNSLLADRKGIETLLRNGQGQMPAVGKNWTAAQLDALISWTKQYAKSGAK*
Ga0137390_1112176023300012363Vadose Zone SoilGPALAGNSLLADRKGIETLLRKGQGQMPAVGKNWTAAQLDALISWTKQYVKGGAK*
Ga0157355_100705813300012493Unplanted SoilPDLGGNPTLTDRAGLETLLRNGTGTMPPVGRGWTDAQIDALAAYTKTLPGASSGG*
Ga0157338_106221113300012515Arabidopsis RhizosphereEQLLRNGRGQMPAVGGAWSDAQIDALVAYTKQFAASGGS*
Ga0137416_1057057213300012927Vadose Zone SoilGIEVLLRSGRGQMPSVGRDWSSSQIDALIAYTKQFAGGASG*
Ga0164303_1098006223300012957SoilGNALLADRHGLETLLRNGRGAMPAVGKNWSAAQIDALIAWTKQYAKGGSTGGG*
Ga0164299_1014933323300012958SoilLLTRRSGLETLLRNGRRQLPAVGKNWTAPQIDALVAYNKTLAKGGAG*
Ga0164299_1117954113300012958SoilLKGNSLLANRAGIEQLLRNGRGQMPAVGGAWSDAQIDALVSYTKQFAQKGGS*
Ga0164301_1036626123300012960SoilALGGNSLLTQRSGLETLLRNGRGQMPAVGKNWTDHQIDALVAYNKTLAKGGAG*
Ga0164302_1007575423300012961SoilGRGQMPSVGKDWTRQQLDALVAYTKQFAKTGGSG*
Ga0168317_106775213300012982Weathered Mine TailingsALAGNPLLADRKGIEVLLRNGQGQMPSVGRDWTGKQLDALIAYTKQFAKPRSGG*
Ga0164307_1161647113300012987SoilRKGIETLLRNGRGKMPAVGKTWSGAQIDALISWTKQYAKAGGS*
Ga0164306_1042419323300012988SoilLLADRHAIEVLLRNGRGQMPSVGKDWTRQQLDALVAYTKQFAKTGGSG*
Ga0164306_1066238823300012988SoilGPALQGNALLADRRGIETLLRNGRGNMPAVGKNWTDAQIDALISWTKQYASTGAAQ*
Ga0164306_1078984323300012988SoilLRGNSLLANRAGLEQLLRNGRGQMPKVGAGWSDAQIDALVAYTKQFAKGGS*
Ga0164305_1037268423300012989SoilLGGNTLLADRHAIEVLLRNGRGQMPSVGKDWTRQQLDALVAYTKQFAKTGGSG*
Ga0164305_1080291723300012989SoilALQGNALLADRRGIETLLRNGRGNMPAVGKNWTDAQIDALISWTKQYASTGAAQ*
Ga0157370_1137020023300013104Corn RhizosphereCHRLDHKYVGPALGGNPLLGDVKGISALLRNGGIMMPAVGKNWTDAQIQALIAYTKQFSKGAA*
Ga0157369_1105692123300013105Corn RhizosphereRNGQGQMPSVGKDWSDKQIDALVAYTKRYAKAGG*
Ga0120154_114183113300013501PermafrostLLRNGQGQMPSVGKDWTSQQLDALVAYTKQFAKQGGNG*
Ga0120173_104870923300014031PermafrostIETLLRNGRGLMPAVGKNWSSAQIDALISWTKQYVKGGGK*
Ga0182019_1089713113300014498FenNPLLADPKGITSLLRNGRGQMPAVGKNWTGPQIAALVSYTKRFAKASG*
Ga0134072_1021044923300015357Grasslands SoilIGPALGGNPVLADRRGMARLLRQGQGQMPSVGRNWSAHQIDALVAYTTQFAKGGTG*
Ga0132257_10207998413300015373Arabidopsis RhizosphereRLDKPFIGPALGGNPLLADPARITPLLRQGQGQMPAVGRNWTRAQIDALTTYTKQFAKAGGG*
Ga0182033_1065342223300016319SoilITTLLRNGQGNMPAVGHNWTRAQIDALTSYTKRFAKTGG
Ga0182035_1189159713300016341SoilHALETLLRQGQGKMPAVGKNWTSHEMNALVDYTKQFAKKG
Ga0184624_1015573923300018073Groundwater SedimentVRNGRGQMPAVGAGWSDEQIETLVSYTKTIAGGGQ
Ga0206351_1019144813300020077Corn, Switchgrass And Miscanthus RhizosphereALAGNPLLADRKGIETLLRNGVSGPIGQMPAVGKNWSGHQIDALIAYTKQFAKGGG
Ga0154015_136023323300020610Corn, Switchgrass And Miscanthus RhizosphereGGNPLLGEAKSLTPLLRNGQGQMPPVGKNWTEGQIQALVAYTKQFAKGGSS
Ga0154015_136165523300020610Corn, Switchgrass And Miscanthus RhizosphereGLSTLLRNGGTRMPAVGKNWTDAQIQALVSYTKQFSKQGGGG
Ga0193699_1013291123300021363SoilQHAIEVLLRNGQGQMPSVGKDWTSQQFDALIAYTKRFAKTGGAG
Ga0193698_105377913300021968SoilLGGNPLLADRHAIEVLLRNGQGQMPSVGKDWTSQQFDALIAYTKRFAKTGGAG
Ga0224712_1022276323300022467Corn, Switchgrass And Miscanthus RhizosphereLGDRRGIETLLRNGQGQMPSVGKDWSDKQIDALVAYTKRYAKAGG
Ga0247666_101991023300024323SoilIGPALGGNPLLGDRKAIEVLLRNGQGQMPSVGKDWTSQQLDALIAYTKQFAKSGGNG
Ga0207933_122207523300025679Arctic Peat SoilLLADRKGIETLLRNGRGNMPAVGKSWSGAQIDALISWTKRYAKAGA
Ga0208357_107311313300025703Arctic Peat SoilADRKGIETLLRNGRGKMPAVGKSWSGAQIDALISWTKQYAKAGAVG
Ga0207707_1008369833300025912Corn RhizosphereLGDRKGIETLLRNGGVQMPPVGRDWSGKQIDALVAYTKRFAKVGG
Ga0207707_1128645713300025912Corn RhizosphereHAYIGPALSGNSLLGDRKGIETLLRNGRGQMPAVGKNWTGAQIDALIAWTKQYTKGGGK
Ga0207663_1034501713300025916Corn, Switchgrass And Miscanthus RhizosphereIETLLRNGRGNMPAVGNNWTDAQIDALISWTKRYASTGAAG
Ga0207652_1013963913300025921Corn RhizosphereALNGNPLLGDRKGIETLLRNGGVQMPPVGRDWSGKQIDALVAYTKRFAKVGG
Ga0207650_1192244123300025925Switchgrass RhizosphereGIETLLRDGGVQMPPVGRDWSDGQIDALVAYTKRFAKAGG
Ga0207690_1065688913300025932Corn RhizosphereGPALQGNPLLADRKGMETLLRKGGIQMPSVGRDWSDKQIDALVAYTKRFAAAGG
Ga0207686_1013233413300025934Miscanthus RhizosphereALAPLLRDGRGQMPAVGRTWTPHQITALVSYTKRFAKSGGGGGG
Ga0207686_1093335723300025934Miscanthus RhizosphereAGLEQLLRNGRGQMPKVGAGWSDAQIDALVAYTKQFAKGGS
Ga0207639_1048786613300026041Corn RhizosphereLDHPYIGPALAGNPLLGDAKGLSTLLRNGGTRMPAVGKNWTDAQIQALVSYTKQFSKQGGGG
Ga0207702_1153058713300026078Corn RhizosphereQLLRNGRGQMPKVGAGWSDAQIDALVAYTKQFAKGGS
Ga0209470_135339323300026324SoilLADRKGIETLLRNGGTRMPAVGRNWTGAQIDALIAWTKQYAKAAQ
Ga0209074_1020538913300027787Agricultural SoilKGLTTLLRNGQGQMPSVGRDWSDRQIDALVAYTKRFAKAGG
Ga0209006_1133077913300027908Forest SoilPALGGNSLLANRKGIESLLRNGEGQMPAVAKNWTSAQIDALISYTKQFATASSG
Ga0307322_1015571823300028710SoilLLANRAALEQLLRNGRGQMPKVGAGWSDAQIDALVAYTKQFAKGGS
Ga0307316_1007622223300028755SoilLRGNSLLANRAALEQLLRNGRGQMPKVGAGWSDAQIDALVAYTKQFAKGGS
Ga0307306_1018766023300028782SoilRAALEQLLRNGRGQMPKVGAGWSDAQIDALVAYTKQFAKGGS
Ga0307504_1024981223300028792SoilADRKSIETLLRNGGIQMPSVGRDWSAHQIDALVAYTKRFAKAGG
Ga0265338_1072740313300028800RhizosphereTSLLRNGQGQMPAVGKNWTDAQIAALVSYTKRFAKASG
Ga0307310_1074481713300028824SoilLGGNSLLGDRKGIETLLRNGRGQMPAVGKNWTGAQIDALIAWTKQYTKLGAK
Ga0311333_1073853923300030114FenALGNNPLLGDVAGLTTLLRNGGNQMPAVGKNWTDAQIQALVAYTKQYASGYSP
Ga0311333_1089687013300030114FenNNPLLADRKGIETLLRNGQGQMPPVGKNWTPEQIDALVAYTKQFAKGGTS
Ga0311349_1041683623300030294FenRKGIETLLRNGQGQMPPVGKNWTPEQIDALVAYTKQFVKGGTS
Ga0311335_1126037913300030838FenETLLRNGQGQMPPVGKNWTPEQIDALVAYTKQFVKGGAS
Ga0073997_1126458613300030997SoilAGNSLLGDRKGIETLLKEGRGQMPAVGKNWTGEQIDALIAWTKQYVKAAGK
Ga0170824_12521791113300031231Forest SoilIGPALGGNPLLSDVSGLTTLLRNGQGQMPAVGKNWTNAQIEALVAYTKHLPKGGGS
Ga0265340_1055942623300031247RhizosphereHKYIGPALGGNPLLSDVKGLTTLLRSGQGQMPAVGKNWTDAQIQALVAYTKTLPKGSG
Ga0265339_1058514723300031249RhizosphereGNPLLSDVKGLTTLLRSGQGQMPAVGKNWTDAQIQALVAYTKQFPKGSG
Ga0265327_1014287723300031251RhizosphereLLSDVKGLTTLLRSGQGQMPAVGKNWTDAQIQALVAYTKQFPKGSG
Ga0307408_10045153023300031548RhizosphereKGIETLLRNGGIKMPAVGNTWTDEQIDALVAYTKRFAKEGGEGGGQG
Ga0318571_1012699923300031549SoilYIGPALGGNPLLADEHALETLLRQGQGKMPAVGKNWTSHEMNALVDYTKQFAKKG
Ga0318560_1010178813300031682SoilALETLLRQGQGKMPAVGKNWTSHEMNALVDYTKQFAKKG
Ga0265342_1015361123300031712RhizosphereRLDHSYIGPALGGNPLLSDVKGLTTLLRSGQGQMPAVGKNWTDAQIQALVAYTKTLPKGS
Ga0318526_1046342713300031769SoilCHRLDHAFIGPALGGNPLLAEPARITPLLRQGQGQMPAVGHNWTRAQIDALVSYTKQFAKTGG
Ga0318567_1081984913300031821SoilGGNPLLADRKGIASLLRKGGTTMPPVGKNWTPYQIDALVAYTSQFAKKGP
Ga0306925_1185914223300031890SoilLLRQGQGQMPAVGHNWTRAQIDALVSYTKQFAKTGG
Ga0318536_1006991913300031893SoilTYIGPPLGGNPLLAQPLQITTLLRNGQGNMPAVGHNWTRAQIDALTSYTKMFAKTGG
Ga0318522_1029404613300031894SoilLGGNPLLADEHALETLLRQGQGKMPAVGKNWTSHEMNALVDYTKQFAKKG
Ga0308175_10079492113300031938SoilHAYVGPALGGNPLLGDVKGLTTLLRNGQGQMPPVGKNWTHAQIQALVSYTRRFAKQGGGG
Ga0306922_1086224313300032001SoilRITPLLRQGQGQMPAVGHNWTRAQIDALVSYTKQFAKTGG
Ga0318514_1013416813300032066SoilGNPLLAEPARITPLLRQGQGQMPAVGHNWTRAQIDALVSYTKQFAKTGG
Ga0307415_10058279913300032126RhizosphereGGIKMPAVGNTWTDEQIDALVAYTKRFAKEGGEGGGQG
Ga0335080_1020307733300032828SoilPLGGNPLLAEPVAITTLLRNGQGNMPAVGHNWTRAQIDALTSYTKQFAKTGG
Ga0335076_1009403113300032955SoilRLDHTYIGPPLGGNPLLAEPVAITTLLRNGQGNMPAVGHNWTRAQIDALTSYTKQFAKTG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.