NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087826

Metagenome / Metatranscriptome Family F087826

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087826
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 181 residues
Representative Sequence GVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGGSTT
Number of Associated Samples 99
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.45 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(62.727 % of family members)
Environment Ontology (ENVO) Unclassified
(32.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.182 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 45.71%    β-sheet: 12.57%    Coil/Unstructured: 41.71%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13632Glyco_trans_2_3 10.91
PF13641Glyco_tranf_2_3 5.45
PF00535Glycos_transf_2 0.91
PF13578Methyltransf_24 0.91
PF00005ABC_tran 0.91



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10138999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium978Open in IMG/M
3300004082|Ga0062384_100190827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1200Open in IMG/M
3300004631|Ga0058899_12180401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus641Open in IMG/M
3300005184|Ga0066671_10082005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus1739Open in IMG/M
3300005435|Ga0070714_100271229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus1573Open in IMG/M
3300005435|Ga0070714_101217601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300005436|Ga0070713_101703820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300005445|Ga0070708_100105900All Organisms → cellular organisms → Bacteria2581Open in IMG/M
3300005575|Ga0066702_10175653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1284Open in IMG/M
3300005610|Ga0070763_10481314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300006059|Ga0075017_101415568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus547Open in IMG/M
3300006163|Ga0070715_10160699All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300006172|Ga0075018_10627501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus574Open in IMG/M
3300006755|Ga0079222_10637531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium825Open in IMG/M
3300010046|Ga0126384_12012716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300010154|Ga0127503_10922281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300010366|Ga0126379_13628923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300012212|Ga0150985_116819726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium772Open in IMG/M
3300012582|Ga0137358_10167119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1500Open in IMG/M
3300012987|Ga0164307_11760191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300015357|Ga0134072_10101548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium886Open in IMG/M
3300016357|Ga0182032_10211593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1483Open in IMG/M
3300016387|Ga0182040_11162051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium648Open in IMG/M
3300016422|Ga0182039_11129755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300020579|Ga0210407_11064264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300020580|Ga0210403_10532696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium952Open in IMG/M
3300020580|Ga0210403_11054726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300020581|Ga0210399_10727637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium814Open in IMG/M
3300020581|Ga0210399_10776698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium783Open in IMG/M
3300020581|Ga0210399_11195208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300020581|Ga0210399_11450520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300020582|Ga0210395_10679349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium771Open in IMG/M
3300020582|Ga0210395_10782493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300020583|Ga0210401_10468402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1122Open in IMG/M
3300021170|Ga0210400_10115619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2136Open in IMG/M
3300021171|Ga0210405_10032823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4152Open in IMG/M
3300021171|Ga0210405_10132155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1974Open in IMG/M
3300021171|Ga0210405_10440671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1024Open in IMG/M
3300021180|Ga0210396_10494636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1070Open in IMG/M
3300021401|Ga0210393_11166019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300021403|Ga0210397_10435148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium985Open in IMG/M
3300021405|Ga0210387_11716814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300021406|Ga0210386_11215188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300021420|Ga0210394_11050023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M
3300021474|Ga0210390_11434595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300021479|Ga0210410_10693693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium899Open in IMG/M
3300021560|Ga0126371_13576105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300022498|Ga0242644_1013318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300022511|Ga0242651_1022099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300022523|Ga0242663_1009647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1272Open in IMG/M
3300022529|Ga0242668_1061969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300022530|Ga0242658_1061477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium821Open in IMG/M
3300022708|Ga0242670_1052998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300022712|Ga0242653_1080672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300022715|Ga0242678_1046375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300022722|Ga0242657_1026559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1139Open in IMG/M
3300022724|Ga0242665_10009226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1957Open in IMG/M
3300022724|Ga0242665_10336962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300022726|Ga0242654_10134757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300023046|Ga0233356_1040364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300025898|Ga0207692_10066147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1889Open in IMG/M
3300025915|Ga0207693_11336131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300025916|Ga0207663_10998450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300026356|Ga0257150_1008950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1350Open in IMG/M
3300026494|Ga0257159_1044725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300027703|Ga0207862_1164020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis663Open in IMG/M
3300027727|Ga0209328_10048872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1299Open in IMG/M
3300027910|Ga0209583_10108315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1082Open in IMG/M
3300029636|Ga0222749_10061864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1679Open in IMG/M
3300029636|Ga0222749_10407524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium721Open in IMG/M
3300029701|Ga0222748_1038477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium780Open in IMG/M
3300030916|Ga0075386_12008035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300030969|Ga0075394_11540718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300031231|Ga0170824_105877136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1193Open in IMG/M
3300031543|Ga0318516_10825152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300031546|Ga0318538_10025601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2694Open in IMG/M
3300031564|Ga0318573_10166381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1161Open in IMG/M
3300031680|Ga0318574_10199399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1149Open in IMG/M
3300031682|Ga0318560_10236190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium980Open in IMG/M
3300031719|Ga0306917_10304117All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300031747|Ga0318502_10155330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1307Open in IMG/M
3300031753|Ga0307477_10225341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1301Open in IMG/M
3300031768|Ga0318509_10207422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1091Open in IMG/M
3300031770|Ga0318521_11025325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300031780|Ga0318508_1178520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300031782|Ga0318552_10433213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300031792|Ga0318529_10095710All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300031795|Ga0318557_10092463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1330Open in IMG/M
3300031819|Ga0318568_10244088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1112Open in IMG/M
3300031833|Ga0310917_11167965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031835|Ga0318517_10094245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1309Open in IMG/M
3300031845|Ga0318511_10088876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1301Open in IMG/M
3300031879|Ga0306919_11008088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300031880|Ga0318544_10054037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1456Open in IMG/M
3300031941|Ga0310912_10365803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1121Open in IMG/M
3300031946|Ga0310910_10092125All Organisms → cellular organisms → Bacteria2234Open in IMG/M
3300031954|Ga0306926_10909138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1053Open in IMG/M
3300031954|Ga0306926_11455637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium792Open in IMG/M
3300032041|Ga0318549_10087236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1345Open in IMG/M
3300032042|Ga0318545_10241711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium648Open in IMG/M
3300032055|Ga0318575_10611720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300032059|Ga0318533_10552159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300032065|Ga0318513_10602520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300032076|Ga0306924_10813358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1041Open in IMG/M
3300032090|Ga0318518_10447498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300032094|Ga0318540_10109824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1303Open in IMG/M
3300032180|Ga0307471_103412307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300032205|Ga0307472_101702566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300032261|Ga0306920_102022231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium806Open in IMG/M
3300033290|Ga0318519_10139647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1345Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil62.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.91%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023046Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MSEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1013899923300003505Forest SoilTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT*
Ga0062384_10019082723300004082Bog Forest SoilSRKEHAFTEIWSRSGRFFESDGVSLLLLDNGAYFVRTATGIEEVDFDTFSLPVRSGTDGTAERPRGFYEEPVTRLLNPPADVRNDALLWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFVLAIGSAFATNTLPDPIISMAIRDIELLPLLYLLPAAPAIVGGLLLAGSGVRRPRLSDSGEGSIS*
Ga0058899_1218040113300004631Forest SoilWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT*
Ga0066671_1008200513300005184SoilLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGTPEGTEERPRGFYEEPVTRLLNPPIDVRDDTLILAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRRGRRQTLLFMLAVASAFATNTLPDPIITMVIRNIELLPLLYLLPTVPGLVGGLLLARSGIRRPMLSGGGSSIA*
Ga0070714_10027122913300005435Agricultural SoilEHSFTEIWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGGSTT*
Ga0070714_10121760123300005435Agricultural SoilKEHSFTEIWARRGRFLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGKPEGTEERPRGFYEEPVTRLLNPPTEVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFMLAVASAFATNTLPDPIITMVIRNIELLPLLYLLPAVPAIAGGLLLAGSGMRRPTFSGGASIT*
Ga0070713_10170382013300005436Corn, Switchgrass And Miscanthus RhizosphereVEVLQPGYQQEIIPGVSVAFARRSLDGTTLEDIVALDSRKEHRFTEILSRRGRFLERDGASLLLLDTGAYFVHTATGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQEKRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPLLYLLPTM
Ga0070708_10010590013300005445Corn, Switchgrass And Miscanthus RhizosphereKEHVFTEIWAPRGRILEIDQDSLLLLEGGAYFVHTATGMEKIEFDTFSLPVRSGTLGGKAERARGFYEEPVTRLLNPPSEVRNDTLVCAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRRGVGQTLLFMLAVASALATNTLPDPIISMAIHNIELLPVLYLMPTIPAIVGALLLARE*
Ga0066702_1017565313300005575SoilGIEKVDFDTFSLPVRIGTSERTEERPRGFYEEPVTRLLNPPIDVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFMLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTLPALVGGLLLAGRGMRHPMLSGGGSSIT*
Ga0070763_1048131413300005610SoilATGIEKVDFDTFSLPVRIGPPEGTEERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRWQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT*
Ga0075017_10141556813300006059WatershedsIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQALLFVLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGGSIT*
Ga0070715_1016069913300006163Corn, Switchgrass And Miscanthus RhizosphereGISLLVLDSGAYFVRTATGIKKVDFDTFSLPVPTGTPGGAAPRQRGFYEEPVKRLLNPPIEVRIDTRVWARWLVEGHRRIINPLLCFGNVVLVLGLLVPRRQRVGQTLMFALAVASAFATNTLPDPIISLATRNIELLPVLYLMPTVPAIVGGLLLAGSDMRRPWFSAHGRSWHHRFAPAQLSDGRAPK*
Ga0075018_1062750113300006172WatershedsSDGVSLLLLDTGAYFVHTATGIKKVDFDAFSLSVPIGAPGGAAQRPRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCIGNVVLVLGLLVPRRQGVGQTFMFGLALASAFATNTLPGPLISMATRNINLMPVLYLMPTVPAIVGGVLLAGSDMHRPWFSAWQRRPNYVNEIRTLIRDPT*
Ga0079222_1063753123300006755Agricultural SoilARRGRFLESDGVSLLMLDSGAYFVRTASGIEKVDFDKFSLPVRIGKPERTEERPRGFYEEPVTRLLNPPTEVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFMLAVASAFATNTLPDPIITVVIRNIELLPLLYLLPAVPAIAGGLLLAGSGMRRPTFSGGGSIT*
Ga0126384_1201271613300010046Tropical Forest SoilQQEIAPSLSVAFSRRSLDGTTLEDIVALDGRKENVFTQIWARRGRVHESDGVSLLLLDSGAYFVHTARGIKKIDFEAFSLPVLIGTPGGAAQRPRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRHGVGQTLMFGLAVASAFATNTLPGPLISMATRN
Ga0127503_1092228113300010154SoilKVDFEAFSLPVPIGAPGGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAHWLAEGHRRIINPLLCLGNVVLVLGLLVPRRQGAGQTLMFGLAVASAFATNTLPGPLISMATRNISLMPVLYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT*
Ga0126379_1362892313300010366Tropical Forest SoilRKEHAFTQIWARRGRFVESDGGFLLLFDSGAYFVHTATRIKKVVFDTFSVPVPIGALEGPAQRPHGFYEEPINQLLKPPMEIGNDPVVAAQWLVEGHRRIINPLLCVGNVVLVLGLLLPRRQGMGQTIMFALAVVSALATNTLPDPIISTAARNLNLLPVLYLMPTVPAIVG
Ga0150985_11681972613300012212Avena Fatua RhizosphereGRKEHSFTEILARRGRFLESHGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGKPEGTEERPRGFYEEPVTRLLNPPTEVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFMLAVASAFATNTLPDPIITVVIRNIELLPLLYLLPAVPAIAGGLLLAGSGMRRPRFFGGGSTT*
Ga0137358_1016711913300012582Vadose Zone SoilIVALDGRNEHSFTEIWARRGRFLEIDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGKPEGTEERPRGFYEEPVTRLLNPPTEVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDRGSTT*
Ga0164307_1176019113300012987SoilDGTTLEDIVALDGRKEHAFTQIWARRGRFLESDGISLLLLDSGAYFLRTATGIKKVDFDTFSLPVPTGTPGGAAPRPRGFYEEPVKRLLNPPIEVRIDTRVWARWLVEGHRRIINPLLCFGNVVLVLGLLVPRRQRVGQTLMFALAVASAFATNTLPDPIISLATRNIELLPVL
Ga0134072_1010154823300015357Grasslands SoilQRGRFLESDGVSLLLLDSGAYFVRTATGIEKVEFDTFSLPVRIGAPEGTEERPRGFYEEPVTRLLNPPIDVRDDTLILAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRRGRRQTLLFMLAVASAFATNTLPDPIITMVIRNIELLPLLYLLPTVPGLVGGLLLARSGIRRPMLFGGGSSIT*
Ga0182032_1021159323300016357SoilDSRKEHRFTEILSRRGRFLERDGVSLLLLDTGAYFVHTATGIEKVDFDRFSLPVRIGAPEGAERPRGFYEEPITRLLNPPIEAREDALVWAQWLVEGHRRIVNPLVCVGNVVLVLGLLVPRRPERRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPLLYLLPTMPAIVGGLLLAGGGMRRQRLSGAGNGSIT
Ga0182040_1116205113300016387SoilAFSLSLPIGAPGGAPQRPRGFYEEPVKQLINPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMRRPWFSALPRRPNYVNEIQTLIRDPN
Ga0182039_1112975523300016422SoilAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLTQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGVLLAGSDMRRPCFSAWPRRPNYVNEIRTLIRDPT
Ga0210407_1106426413300020579SoilEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0210403_1053269613300020580SoilFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSI
Ga0210403_1105472613300020580SoilVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRAPEGTEERPRGFYEEPVTRLLNPPIDARNDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLLPTVPAIVGGLLLTGSGTRRAKLSGVGDGSIM
Ga0210399_1072763713300020581SoilGLEVLQPGYQQEIIPGVSVAFARRSLDGTTLEDIVALDSRKEHRFTEILSRRGRFLERDGVSLLLLDTGAYFVHTATGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDAQIWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQERRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPLLYLLPTMPAIVGGLLLAGSGMRRQRLSGAGDGSIT
Ga0210399_1077669823300020581SoilGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGDSTT
Ga0210399_1119520813300020581SoilCGGPQRRRTATRLSAGNRPSLSVAFSRRSLDGTTLEDIVALDGRNEHAFTQIWARRGRVLESDGVSSLLLDSGAYFVHTARGIKKVDFEAFSLPVPIGAPGGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAHWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGAGQTLMFGLAVASAFATNTLPGPLISMATRNISL
Ga0210399_1145052013300020581SoilGRFLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGKPEGTEERPRGFYEEPFTRLLNPPIEVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFMLAVASAFATNTLPDPIITMAIRNIKLLPLLYLMPTVPAIVGGLLLAGSGMRRPTFSGGGS
Ga0210395_1067934913300020582SoilGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIISIAIYHIELLPLLYLLPTMPAIVGGLLLAGSGMRRQRLSGAGNGSIT
Ga0210395_1078249323300020582SoilERPRGFYEEPVTRLLNPPIDARNDALVWGQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLLPTVPAVVGGLLLIGSGTRRAVSATARSCDADPRAISTGEANPFWCPHKA
Ga0210401_1046840223300020583SoilWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0210400_1011561913300021170SoilIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0210405_1003282343300021171SoilAFARRSLDGTTLEDIVALDSRKEHRFTEILSRRGRFLERDGASLLLLDTGAYFVHTATGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDAQIWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQERRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPLLYLLPTMPAIVGGLLLAGSGMRRQRLSGAGNGSIT
Ga0210405_1013215523300021171SoilEIWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0210405_1044067123300021171SoilYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0210396_1049463613300021180SoilLLLDTGAYFVHTATGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQERRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPLLYLLPTMPAIVGGLLLAGSGMRRQRLSGAGDGSIT
Ga0210393_1116601913300021401SoilAAANVGVEVLQPGYQQEILPGISVAFARRSRDGTTLEDIVALDSRKEHEFTEIWSRRGRFFESGGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRAPEGTEERPRGFYEEPVTRLLNPPIDARNDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLL
Ga0210397_1043514813300021403SoilILPGISVAFARRSRDGTTLEDIVALDSRKEHEFTEIWSRRGRFFESGGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRAPEGTEERPRGFYEEPVTRLLNPPIDARNDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLLPTVPAVVGGLLLIGSGTRRAKLSGVGDGSIM
Ga0210387_1171681413300021405SoilSAAFARRSLDGTTLEDIVALDSRKEHRFTEILSRRGRFLERDGVSLLLLDTGAYFVHTATGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDAQIWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQERRQTLLFVLAVASAFATNTLPDPIISIAIYHIE
Ga0210386_1121518813300021406SoilGRKEHSFTEIWARRGRFLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGKREGTEERPRGFYEEPFTRLLNPPIEVRDDTLMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTFLFMLAIASAFATNTLPDPIITMAIRNIELLPLLYLMPTLPAIVGGLLLAGNGMRRPTFSGGGLIT
Ga0210394_1105002313300021420SoilVAFARRSRDGTTLEDIVALDSRKEHEFTEIWSRRGRFFESGGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRAPEGTEERPRGFYEEPVTRLLNPPIDARNDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLLPTVPAVVGGLLLIGSGTRRAKLSGVGDGSIM
Ga0210390_1143459513300021474SoilTATGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQERRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPFLYLLPTMPAIVGGLLLAGSGMRRQRLSGAGDGSIT
Ga0210410_1069369323300021479SoilLDGRNEHSFTEIWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0126371_1357610513300021560Tropical Forest SoilRKEHAFTQIWARRGRFVESDGGFLLLFDSGAYFVHTATRIKKVVFDTFSVPVPIGAPGGPAQRPHGFYEETVKQLLNPPVEIRNDPVVLAQWLVEGHRRVINPLLCVGNVVLVLGLLVPRRQGVGQTLMFALAVVSALATNTLPDPIISMAACNINLLPVLYLMPTVPAIVGGL
Ga0242644_101331813300022498SoilEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTLPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0242651_102209923300022511SoilYFGRSATGIEKVDFDTFPLPVVTPEGTKERPRGFYEEPVTRLLNPPIDVRDDAPMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPAIVGGLLLAGSGMRHPLLSGGGGNGSIT
Ga0242663_100964713300022523SoilTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDAPMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0242668_106196913300022529SoilFDTFSLPVRIGTPEGTAERPRGFYEEPVTRLLNPPMDVRNDRLTLAPWLVAGHRRIVNPLLCVGHVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPLLSGGGGNGSIT
Ga0242658_106147723300022530SoilNEHSFTEIWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRMPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGDSTT
Ga0242670_105299813300022708SoilFDTFSLPVRAPEGTEERPRGFYEEPVTRLLNPPIDARNDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLLPTVPAVVGGLLLIGSGTRRAKLSGVGDGSIM
Ga0242653_108067213300022712SoilRSATGIEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRQQTLLFGLAVASAFATNTLPDPIITIAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0242678_104637523300022715SoilFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRMPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRQQTLLFGLAVASAFATNTLPDPIITIAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0242657_102655913300022722SoilEIWARRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITIAIRNIELLPLLYLLPTLPALVGGLLLAGRGMRRPMLSGGGGGSIT
Ga0242665_1000922623300022724SoilGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0242665_1033696213300022724SoilFSLPVRAPEGTEERPRGFYEEPVTRLLNPAIDARNDALVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQSLLFVLAVASAFATNTLPDPIISMAIRDIELLPLLYLLPTVPAVVGGLLLIGSGTRRAKLSGVGDGSIM
Ga0242654_1013475713300022726SoilLEDIVALDSRKEHEFTEIWSRRGRFLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGTPEGTAERPRGFYEEPVTRLLNPPIDVKNDRLTLAPWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0233356_104036413300023046SoilSFTEIWARRGRFLEIDGVSLLLLYSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLLEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGGSTT
Ga0207692_1006614713300025898Corn, Switchgrass And Miscanthus RhizosphereIVALDGRKEHAFTQIWARRGRFLESDGISLLLLDSGAYFLRTATGIKKVDFDTFSLPVPTGTPGGAAPRPRGFYEEPVKRLLNPPIEVRIDTRVWARWLVEGHRRIINPLLCFGNVVLVLGLLVPRRQRVGQTLMFALAVASAFATNTLPDPIISLATRNIELLPVLYLMPTVPAIVGGLLLAGSDMRRPWFSAHGRSWHHRFAPAQLSDGRAPK
Ga0207693_1133613113300025915Corn, Switchgrass And Miscanthus RhizosphereLLLLEGGAYFVHTATGMEKIEFDTFSLPVRSGTLGGKAERARGFYEEPVTRLLNPPSEVRNDTLVCAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRRGVEQTLLFMLAVASALATNTLPDPIISMAIHNIELLPVLYLMPTIPAIVGALLLARE
Ga0207663_1099845023300025916Corn, Switchgrass And Miscanthus RhizosphereLPVPTGTPGGAAPRQRGFYEEPVKRLLNPPIEVRIDTRVWARWLVEGHRRIINPLLCFGNVVLVLGLLVPRRQRVGQTLMFALAVASAFATNTLPDPIISLATRNIELLPVLYLMPTVPAIVGGLLLAGSDMRRPWFSAHGRSWHHRFAPAQLSDGRAPK
Ga0257150_100895023300026356SoilFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLLEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGGSTT
Ga0257159_104472523300026494SoilGVSLLLLDSGAYFVRSATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGRRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDGGSTT
Ga0207862_116402013300027703Tropical Forest SoilGAMSLVYVGYVKVKMLPFDNKSEFQVIIDMPDGTTLEDIVALDGRKEHAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTATGIKKVDFQAFSLSVPIGAPGGAAQRARGFYEEPVKQLLNPPIEVRNDPSVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGKTFMFGLAVASAFATNTLPGPLISMATRNINLMPVLYLMPTVPAIVGGVLL
Ga0209328_1004887213300027727Forest SoilGRFLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGTPEGTAERPRGFYEEPVTRLLNPPIDVRNDRLMLAPWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQTLLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0209583_1010831523300027910WatershedsLFDSGAYIVRTATGTEKVAFDTFSLPVRVGMLGGKAARPRGFYEEPVTRLLNPPSDVSNDTLVLAQWLTEGHRRIINPLLCVGNVILVLGLLVPRRQGDFRLKILFVLAVASALATNTLPDPIVLMTIVAVSIVLAGTPGLAAA
Ga0222749_1006186423300029636SoilRRGRFLESDGVSLLLLDSGAYFVRSATGIEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDAPMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0222749_1040752413300029636SoilGIEKVDFDRFSLPVRIGAPEGTERPRGFYEEPITRLLNPPIEAREDARVWAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQERRQTLLFVLAVASAFATNTLPDPIISIAIYHIELLPFLYLLPTMPAIVGGLLLAGSGMRRQRLSGAGDGSIT
Ga0222748_103847723300029701SoilGAYFVRSATGIEKVDFDTFTLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGADGGSTT
Ga0075386_1200803513300030916SoilFLFFSPFSPYYFVHTARGIKEVDFEAFSLPVPIGAPGGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAHWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATRNISLLPVLYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPN
Ga0075394_1154071813300030969SoilAFSLPVPIGAPGGDAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAHWLAEGHRRIINPLLCVGNVVLVLGLLVPGRQGVGQTLMFGLAVASAFATNTLPGPLISMATRNISLLPVLYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0170824_10587713623300031231Forest SoilWIGPPEGTEERPRGFYEEPVTRLLNPPIDVREDTPMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQRRRQTLLFIFAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGDWGSIT
Ga0318516_1082515213300031543SoilMGIKQVDFEAFSLSLPIGALGGAAQLPRGFYEEPVKQLLDPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGVLLAGSDMRRPCFSAWPRRPNYVNEIRTLIRDPT
Ga0318538_1002560153300031546SoilVPAPAELGQARGHDPDGSTLDDIVVLDGRKEHAFTQIWARHGRFVENDRDLLLLFDSGAYFVHTANGIKKVVFDTFSVPVPIGGPAQRPHGFYEESIKQLLNPPIQVRNDPMVLAQSLAEGHRRIINPLLCVGNGTLVLGLLVPTRRRVGQTLMFGLAVASAFATNTLPGPIISMVTRNINLMPILYLMPTVPAIVG
Ga0318573_1016638113300031564SoilSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0318574_1019939913300031680SoilLEDIVVLDGRKEDAFTQVWARRGRVFESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGAPGGAPQRPRGFYEEPVKQLINPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMRRPWFSALPRRPNYVNEIQTLIRDPN
Ga0318560_1023619013300031682SoilFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0306917_1030411733300031719SoilRGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0318502_1015533033300031747SoilHGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0307477_1022534113300031753Hardwood Forest SoilSLPVRIGTPEGTEERPRGFYEEPVTRLLNPPIDVREDTLMLAQWLVEGHRRIVNPLLCVGNVILVLGLLVPRRQGRRQALLFILAVASAFATNTLPDPIITMAIRDIELLPLLYLLPTVPAIVGGLLLAGSGMRHPMLSGGGGNGSIT
Ga0318509_1020742213300031768SoilVFESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGAPGGAAQRPRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMCRPWFSALPRRPNYVNEIRTLIRDSN
Ga0318521_1102532513300031770SoilDSGAYFVHTAKGIKKVDFEAFSLSLPIGALGGAAQLPRGFYEEPVKQLLDPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMCRPWFSALPRRPNY
Ga0318508_117852013300031780SoilATVADLSVDVLQPGYQQEIAPSLSVAFSRRSLDGTTLEDIVVLDGRKEDAFTQVWARRGRVFESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGALGGAAQLPRGFYEEPVKQLLDPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNIS
Ga0318552_1043321313300031782SoilSLSVAFSRRSLDGTTLEDIVALDGRKEDAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEI
Ga0318529_1009571033300031792SoilKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGVLLAGSDMRRPCFSAWPRRPNYVNEIRTLIRDPT
Ga0318557_1009246313300031795SoilLSVAFSRRSLDGTTLEDIVALDGRKEDAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0318568_1024408823300031819SoilQEIAPSLSVAFSRRSLDGTTLEDIVALDGRKEDAFTQIWARHGRVLESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGALGGAAQLPRGFYEEPVKQLLDPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0310917_1116796513300031833SoilSGAYFVHTAKGIKKVDFEAFSLSLPIGAPGGAPQRPRGFYEEPVKQLINPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMCRPWFSALPRRPNYVNE
Ga0318517_1009424523300031835SoilQEIAPSLSVAFSRRSLDGTTLEDIVALDGRKEDAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0318511_1008887633300031845SoilTQIWARHGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0306919_1100808813300031879SoilDVLQPGYQQEIAPSLSVAFSRRSLDGTTLEDIVALDGRKEDAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGV
Ga0318544_1005403713300031880SoilQEIAPSLSVAFSRRSLDGTTLEDIVALDGRKEDAFTQIWARHGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLTVVSAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGVLLAGSDMRRPCFSAWPRRPNYVNEIRTLIRDPT
Ga0310912_1036580323300031941SoilQLPRGFYEEPVKQLLDPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMCRPWFSALPRRPNYVNEIRTPIRDPN
Ga0310910_1009212513300031946SoilDFEAFSLSLPIGAPGGAPQRPRGFYEEPVKQLINPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMRRPWFSALPRRPNYVNEIQTLIRDPN
Ga0306926_1090913813300031954SoilGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGALGGAAQLPRGFYEEPVKQLLDPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMCRPWFSALPRRPNYVNEIRTPIRDPN
Ga0306926_1145563713300031954SoilRPRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPDPLISMSTLNISLMPALYLMPTVPAIVGGVLLAGSDMRRPWFSALPRRPNYVNEIRTLIRDSN
Ga0318549_1008723623300032041SoilWARHGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0318545_1024171113300032042SoilALDGRKEDAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT
Ga0318575_1061172013300032055SoilGFWGAAAPPHPDGSTLDDIVVLDGRKEHAFTQIWARHGRFVENDRDLLLLFDSGAYFVHTANGIKKVVFDTFSVPVPIGGPAQRPHGFYEESIKQLLNPPIQVRNDPMVLAQSLAEGHRRIINPLLCVGNGTLVLGLLVPTRRRVGQTLMFGLAVASAFATNTLPGPIISMVTRNINLMPILYL
Ga0318533_1055215913300032059SoilVFESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGAPGGAPQRPRGFYEEPVKQLINPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPDPLISMSTLNISLMPVLYLMPTVPAIVGCVLLAGSDMRRPWFSALPRRPNYVNEIRTLIRDSN
Ga0318513_1060252013300032065SoilRGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQRLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGVLLAGSDMRRPCFSAWPRRPNYVNEIRTLIRDPT
Ga0306924_1081335813300032076SoilLDGRKEDAFTQVWARRGRVFESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGAPGGAAQRPRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMCRPWFSALPRRPNYVNEIRTPIRDPN
Ga0318518_1044749823300032090SoilDSGAYFVRTASGIEKVDFDTFSLPVRIGKPEGTEERPRGFYEEPFTRLLNPPIEVRDDRLMLVQWLVEGHRRIVNPLLCIGNVVLVLGLLVPRRQGRRQTLLFMLAVASAFATNTLPDPIITMAIRNIELLPLLYLMPTVPAIVGGLLLAGSGMRRPTFSSGGLIT
Ga0318540_1010982443300032094SoilWARHGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTLPAIVGGVLLAGSDMRRPCFSAWPRRPNYVNEIRTLIRDPT
Ga0307471_10341230713300032180Hardwood Forest SoilIKKVNFDAFSLLLPSGAPGGATQRPRGFYEEPVKQLLNPPIDVRNDPMVVAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNMLPGPLISMATRNINLMPVLYLMPTVPAIVGGLLLAGSDMRRPWFSAHGRSWHHRFAPAQLSDGRAPK
Ga0307472_10170256613300032205Hardwood Forest SoilHTFTEIWARRGRFLESDGVSLLLLDSGAYFVRTATGIEKVDFDTFSLPVRIGTPEGTKERPRGFYEEPVTRLLNPPIDVRDDALMLAQWLVEGHRRIVNPLLCVGNVVLVLGLLVPRRQGKRQTLLFGLAVASAFATNTLPDPIITMAIRNIELLPLLYLLPTVPALVGGLLLAGRGMRRPMLSGGGGGSIT
Ga0306920_10202223113300032261SoilRVFESDGVSLLLLDSGAYFVHTAKGIKKVDFEAFSLSLPIGAPGGAAQRPRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLVLGLLVPRRQGVGQTLMFGLAVASAFATNTLPGPLISMATLNISLMPVLYLMPTVPAIVGGVLLAGSDMRRPWFSALPRRPNYVNEIQTLIRDPN
Ga0318519_1013964713300033290SoilIVALDGRKEDAFTQIWARRGRVLESDGVSLLLLDSGAYFVHTARGIKKVDFEAFSLSAPIGAPRGAAQRLRGFYEEPVKQLLNPPIEVRNDPMVLAQWLAEGHRRIINPLLCVGNVVLILGLLVPRRQGVGQTLMFGLAVVSAFATNTLPGPLISMATRNIDVIPILYLMPTVPAIVGGVLLAGSDMRRPWFSAWPRRPNYVNEIRTLIRDPT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.