| Basic Information | |
|---|---|
| Family ID | F087812 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.18 % |
| % of genes near scaffold ends (potentially truncated) | 18.18 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.818 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (9.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02870 | Methyltransf_1N | 51.82 |
| PF00725 | 3HCDH | 12.73 |
| PF02737 | 3HCDH_N | 10.00 |
| PF13649 | Methyltransf_25 | 4.55 |
| PF13517 | FG-GAP_3 | 2.73 |
| PF12847 | Methyltransf_18 | 1.82 |
| PF07963 | N_methyl | 0.91 |
| PF00534 | Glycos_transf_1 | 0.91 |
| PF08281 | Sigma70_r4_2 | 0.91 |
| PF03814 | KdpA | 0.91 |
| PF01197 | Ribosomal_L31 | 0.91 |
| PF00005 | ABC_tran | 0.91 |
| PF09130 | DUF1932 | 0.91 |
| PF07519 | Tannase | 0.91 |
| PF02403 | Seryl_tRNA_N | 0.91 |
| PF13361 | UvrD_C | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 51.82 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 22.73 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 10.91 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 10.00 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 10.00 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 10.00 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 10.00 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 10.00 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.36 % |
| Unclassified | root | N/A | 23.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100636059 | Not Available | 2531 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100636617 | Not Available | 526 | Open in IMG/M |
| 3300004157|Ga0062590_102857986 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005329|Ga0070683_100027096 | All Organisms → cellular organisms → Bacteria | 5166 | Open in IMG/M |
| 3300005329|Ga0070683_100039179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4349 | Open in IMG/M |
| 3300005329|Ga0070683_101138365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 750 | Open in IMG/M |
| 3300005338|Ga0068868_100456731 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005345|Ga0070692_10095218 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300005355|Ga0070671_100159915 | Not Available | 1904 | Open in IMG/M |
| 3300005439|Ga0070711_101341055 | Not Available | 621 | Open in IMG/M |
| 3300005458|Ga0070681_10272689 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300005471|Ga0070698_101149218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300005529|Ga0070741_10000349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 173346 | Open in IMG/M |
| 3300005534|Ga0070735_10009808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7411 | Open in IMG/M |
| 3300005535|Ga0070684_100039364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4066 | Open in IMG/M |
| 3300005538|Ga0070731_10304171 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1059 | Open in IMG/M |
| 3300005541|Ga0070733_10980650 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005542|Ga0070732_10250967 | Not Available | 1060 | Open in IMG/M |
| 3300005543|Ga0070672_100215533 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300005549|Ga0070704_101831588 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005563|Ga0068855_100020585 | All Organisms → cellular organisms → Bacteria | 7911 | Open in IMG/M |
| 3300005563|Ga0068855_100411081 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300005563|Ga0068855_100598070 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300005563|Ga0068855_101884187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300005566|Ga0066693_10390532 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005614|Ga0068856_100115273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2686 | Open in IMG/M |
| 3300005614|Ga0068856_100161683 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300005718|Ga0068866_10718403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 687 | Open in IMG/M |
| 3300005829|Ga0074479_10642098 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005836|Ga0074470_11397136 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300005841|Ga0068863_100705340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1003 | Open in IMG/M |
| 3300005842|Ga0068858_100137760 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300005842|Ga0068858_100819939 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005843|Ga0068860_100922116 | Not Available | 890 | Open in IMG/M |
| 3300006163|Ga0070715_10304455 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006173|Ga0070716_100904202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300006175|Ga0070712_100695908 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006176|Ga0070765_100388071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300006237|Ga0097621_101380941 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006358|Ga0068871_100967998 | Not Available | 791 | Open in IMG/M |
| 3300006358|Ga0068871_101034024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 766 | Open in IMG/M |
| 3300006638|Ga0075522_10000023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 82010 | Open in IMG/M |
| 3300006804|Ga0079221_10138062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300006854|Ga0075425_101193635 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300009098|Ga0105245_10635406 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300009098|Ga0105245_11392607 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009098|Ga0105245_12051744 | Not Available | 625 | Open in IMG/M |
| 3300009143|Ga0099792_10499616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 761 | Open in IMG/M |
| 3300009147|Ga0114129_12279899 | Not Available | 650 | Open in IMG/M |
| 3300009174|Ga0105241_11085913 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 753 | Open in IMG/M |
| 3300009176|Ga0105242_10610295 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300009177|Ga0105248_11166972 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300009545|Ga0105237_10199699 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300010359|Ga0126376_11622325 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300010375|Ga0105239_13472972 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010375|Ga0105239_13580092 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010379|Ga0136449_100411802 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 2392 | Open in IMG/M |
| 3300010403|Ga0134123_11803716 | Not Available | 665 | Open in IMG/M |
| 3300010403|Ga0134123_12344713 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012982|Ga0168317_1036836 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300013104|Ga0157370_10006591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12769 | Open in IMG/M |
| 3300013296|Ga0157374_10213956 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300013297|Ga0157378_12514095 | Not Available | 567 | Open in IMG/M |
| 3300013307|Ga0157372_11765847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300014325|Ga0163163_10403238 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300014501|Ga0182024_10571979 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300014969|Ga0157376_10218288 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300014969|Ga0157376_12508130 | Not Available | 555 | Open in IMG/M |
| 3300017966|Ga0187776_11164013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300017973|Ga0187780_11399478 | Not Available | 515 | Open in IMG/M |
| 3300017993|Ga0187823_10386616 | Not Available | 506 | Open in IMG/M |
| 3300020579|Ga0210407_10658264 | Not Available | 814 | Open in IMG/M |
| 3300021170|Ga0210400_10628562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300021407|Ga0210383_10144063 | Not Available | 2023 | Open in IMG/M |
| 3300021478|Ga0210402_10842196 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300022309|Ga0224510_10522832 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300025862|Ga0209483_1000125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 74211 | Open in IMG/M |
| 3300025898|Ga0207692_10111800 | Not Available | 1516 | Open in IMG/M |
| 3300025899|Ga0207642_10389769 | Not Available | 831 | Open in IMG/M |
| 3300025903|Ga0207680_10364268 | Not Available | 1017 | Open in IMG/M |
| 3300025905|Ga0207685_10296592 | Not Available | 798 | Open in IMG/M |
| 3300025911|Ga0207654_10435344 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 917 | Open in IMG/M |
| 3300025911|Ga0207654_10721876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300025912|Ga0207707_10783457 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300025913|Ga0207695_10004411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19221 | Open in IMG/M |
| 3300025914|Ga0207671_10368946 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300025915|Ga0207693_11440390 | Not Available | 510 | Open in IMG/M |
| 3300025920|Ga0207649_10382924 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300025924|Ga0207694_10021555 | All Organisms → cellular organisms → Bacteria | 4883 | Open in IMG/M |
| 3300025924|Ga0207694_11639394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300025927|Ga0207687_11139967 | Not Available | 670 | Open in IMG/M |
| 3300025935|Ga0207709_10268619 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1254 | Open in IMG/M |
| 3300025935|Ga0207709_10309290 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300025942|Ga0207689_10004744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12258 | Open in IMG/M |
| 3300025949|Ga0207667_10000776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 41369 | Open in IMG/M |
| 3300025981|Ga0207640_10932480 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300026035|Ga0207703_10291341 | Not Available | 1486 | Open in IMG/M |
| 3300026095|Ga0207676_10588843 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300027725|Ga0209178_1057930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1250 | Open in IMG/M |
| 3300027869|Ga0209579_10797868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300027903|Ga0209488_10480949 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300028381|Ga0268264_10839951 | Not Available | 919 | Open in IMG/M |
| 3300028800|Ga0265338_10727887 | Not Available | 683 | Open in IMG/M |
| 3300028906|Ga0308309_10258235 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300031231|Ga0170824_105718060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300031231|Ga0170824_127581706 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031938|Ga0308175_100170911 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300032160|Ga0311301_10334485 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
| 3300032180|Ga0307471_103195701 | Not Available | 581 | Open in IMG/M |
| 3300034090|Ga0326723_0228006 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 9.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.73% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.91% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1006360593 | 3300000364 | Soil | MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK* |
| INPhiseqgaiiFebDRAFT_1006366172 | 3300000364 | Soil | MKTHMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK* |
| Ga0062590_1028579862 | 3300004157 | Soil | MNMALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK* |
| Ga0070683_1000270963 | 3300005329 | Corn Rhizosphere | METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK* |
| Ga0070683_1000391796 | 3300005329 | Corn Rhizosphere | MERPMALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKK* |
| Ga0070683_1011383652 | 3300005329 | Corn Rhizosphere | METPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK* |
| Ga0068868_1004567313 | 3300005338 | Miscanthus Rhizosphere | MHMALVVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK* |
| Ga0070692_100952183 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MERPMALAVLLFVFFVIIVLIALFIFPPTKWTEWFVKKDK* |
| Ga0070671_1001599152 | 3300005355 | Switchgrass Rhizosphere | MKRPMALAVLLFVFFIIVVLIALFIFPPNKWVEWFVKNDKK* |
| Ga0070711_1013410551 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ETPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK* |
| Ga0070681_102726893 | 3300005458 | Corn Rhizosphere | METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK* |
| Ga0070698_1011492182 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRPMALAVLLFVFFIIVVLIALFIFPPNKWVEWFVKKDKK* |
| Ga0070741_1000034937 | 3300005529 | Surface Soil | MKTPMALAVLLFVFFMIVVLIALFIFPPNKWVEWFVKKEKK* |
| Ga0070735_100098085 | 3300005534 | Surface Soil | MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDDKKR* |
| Ga0070684_1000393645 | 3300005535 | Corn Rhizosphere | METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK* |
| Ga0070731_103041712 | 3300005538 | Surface Soil | MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNRKK* |
| Ga0070733_109806502 | 3300005541 | Surface Soil | MALFVLLMVFFFVVVLIALFIFPPNKWVEWLEKDKKK* |
| Ga0070732_102509673 | 3300005542 | Surface Soil | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK* |
| Ga0070672_1002155332 | 3300005543 | Miscanthus Rhizosphere | MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK* |
| Ga0070704_1018315882 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LSIRWRHMALAVLLFVFFVIVVLIALFIFPPNKWVEWFANKDKK* |
| Ga0068855_1000205856 | 3300005563 | Corn Rhizosphere | MALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK* |
| Ga0068855_1004110813 | 3300005563 | Corn Rhizosphere | MALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKK* |
| Ga0068855_1005980702 | 3300005563 | Corn Rhizosphere | MALAVLLFVFFVIIVLITLFIFPPTKWVKWFANPGKKK* |
| Ga0068855_1018841872 | 3300005563 | Corn Rhizosphere | MALAVLLFVFFVIIVLIALFIFPPTKWTEWFVKKDK* |
| Ga0066693_103905322 | 3300005566 | Soil | HSHSIRCRDMALAVLLFVFFIIIVLIGLFVFPPTKWVKWFASETKKK* |
| Ga0068856_1001152732 | 3300005614 | Corn Rhizosphere | MALAVLLFVFFIIIVLIGLFVFPPTKWVKWFASETKKK* |
| Ga0068856_1001616832 | 3300005614 | Corn Rhizosphere | MALAVLLFVFFVIIVLIGLFVFPPTAWVKWFANDHKKK* |
| Ga0068866_107184032 | 3300005718 | Miscanthus Rhizosphere | MKTRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK* |
| Ga0074479_106420982 | 3300005829 | Sediment (Intertidal) | MALVVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK* |
| Ga0074470_113971363 | 3300005836 | Sediment (Intertidal) | MALAVLLFVFFVIVVLIALFIFPPNKWVEWFANKDKK* |
| Ga0068863_1007053402 | 3300005841 | Switchgrass Rhizosphere | MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK* |
| Ga0068858_1001377603 | 3300005842 | Switchgrass Rhizosphere | MALAVLLFVFFIIIALIGLFVFPPTKWVKWFANDNKKR* |
| Ga0068858_1008199392 | 3300005842 | Switchgrass Rhizosphere | MALAVLLFVFFVIIALIGLFVFPPTKWVKWFANDNKKR* |
| Ga0068860_1009221163 | 3300005843 | Switchgrass Rhizosphere | MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKEKKIEKK* |
| Ga0070715_103044552 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LSIRWRHMALAVLLFVFFVIVVLIAFFIFPPNKWVEWFVNKDKK* |
| Ga0070716_1009042022 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MALAVLLFVFFMIIVLIGLFVFPPTKWVKWFASDGKKK* |
| Ga0070712_1006959082 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDHKKR* |
| Ga0070765_1003880712 | 3300006176 | Soil | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFVNKDKK* |
| Ga0097621_1013809412 | 3300006237 | Miscanthus Rhizosphere | MALAVLLFVFFCIIALIGLFVFPPTKWVKWFANDNKKR* |
| Ga0068871_1009679982 | 3300006358 | Miscanthus Rhizosphere | MALAVLLFVFFVIVVLIAFFIFPPNKWVEWFVNKDKK* |
| Ga0068871_1010340242 | 3300006358 | Miscanthus Rhizosphere | MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK* |
| Ga0075522_1000002315 | 3300006638 | Arctic Peat Soil | MALAFLLFVFFVIIVLIGLFIFPPTKWVERFANKEKK* |
| Ga0079221_101380622 | 3300006804 | Agricultural Soil | MKTPMALVVLLFVFFMIVVLIALFIFPPNKWVEWFVKKDKK* |
| Ga0075425_1011936352 | 3300006854 | Populus Rhizosphere | MALAVLLFVFFVIVLLIAFFIFPPNKWVEWFVKKDKK* |
| Ga0105245_106354062 | 3300009098 | Miscanthus Rhizosphere | MALAVLLFVFFVIIALIGLFVFPPTSWVKWFASENKKK* |
| Ga0105245_113926072 | 3300009098 | Miscanthus Rhizosphere | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKGKK* |
| Ga0105245_120517442 | 3300009098 | Miscanthus Rhizosphere | MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVNKDKK* |
| Ga0099792_104996162 | 3300009143 | Vadose Zone Soil | MKTLMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK* |
| Ga0114129_122798992 | 3300009147 | Populus Rhizosphere | MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK* |
| Ga0105241_110859131 | 3300009174 | Corn Rhizosphere | METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVNRDKK* |
| Ga0105242_106102953 | 3300009176 | Miscanthus Rhizosphere | METHMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK* |
| Ga0105248_111669721 | 3300009177 | Switchgrass Rhizosphere | LAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK* |
| Ga0105237_101996992 | 3300009545 | Corn Rhizosphere | MLSIRWRHMALAVLLFVFFVIVVLIGLFVFPPTKWVKWFANDNKKR* |
| Ga0126376_116223252 | 3300010359 | Tropical Forest Soil | MALAVLLFVFFVIVLLIAFFIFPPNKWVEWFVNKDKK* |
| Ga0105239_134729721 | 3300010375 | Corn Rhizosphere | MALAVLLFVFFVIVVLIALFIFPPNKWVEWFAKKDKK* |
| Ga0105239_135800922 | 3300010375 | Corn Rhizosphere | MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKDKKIEKK* |
| Ga0136449_1004118023 | 3300010379 | Peatlands Soil | MALAVLLFVFFVIIVLIGLFVFPPTRWVKWFANDNKKR* |
| Ga0134123_118037161 | 3300010403 | Terrestrial Soil | MALAVLLFVFFIIVLLIALFIFPPNKWVEWFVNKEKKIEQK* |
| Ga0134123_123447132 | 3300010403 | Terrestrial Soil | MALVVLLFVFFVIVLLIAFFIFPPNKWVEWFVKKDKK* |
| Ga0168317_10368362 | 3300012982 | Weathered Mine Tailings | MALAVLLFVFFVIIVLIGLFIFPPTAWVKWFANNDKKK* |
| Ga0157370_100065911 | 3300013104 | Corn Rhizosphere | PQYKMERHMALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK* |
| Ga0157374_102139563 | 3300013296 | Miscanthus Rhizosphere | KNMALAVLLFVFFVIIALIGLFVFPPTSWVKWFASENKKK* |
| Ga0157378_125140951 | 3300013297 | Miscanthus Rhizosphere | MALAVLLFVFFCIIALIGLFVFPPTKWVKWFANDNKKR |
| Ga0157372_117658472 | 3300013307 | Corn Rhizosphere | MALAVLLFVFFVISVLIALFIFPPTKWTEWFVKKDK* |
| Ga0163163_104032383 | 3300014325 | Switchgrass Rhizosphere | LAVLLFVFFIIIALIGLFVFPPTKWVKWFANDNKKR* |
| Ga0182024_105719791 | 3300014501 | Permafrost | MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNKK |
| Ga0157376_102182881 | 3300014969 | Miscanthus Rhizosphere | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFADKDKK* |
| Ga0157376_125081302 | 3300014969 | Miscanthus Rhizosphere | MALAVLLFVFFIIVILIALLIFPPNKSVEWFVKNDKK* |
| Ga0187776_111640132 | 3300017966 | Tropical Peatland | MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKDKK |
| Ga0187780_113994782 | 3300017973 | Tropical Peatland | MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFASGDKKK |
| Ga0187823_103866162 | 3300017993 | Freshwater Sediment | MALAVLLFVFFCIIALIGLFVFPPTKWVKWFANDDKKK |
| Ga0210407_106582642 | 3300020579 | Soil | WRHMALAVLLFVFFIIVVLIALFVFPPNKWVEWFANKDKK |
| Ga0210400_106285622 | 3300021170 | Soil | MALAVLLFVFFVIIALIGLFVFPPTKWVEWFASQNKKK |
| Ga0210383_101440633 | 3300021407 | Soil | MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNKKK |
| Ga0210402_108421962 | 3300021478 | Soil | MALAVLLFVFFVIVVLIALFVFPPTKWVKWFANDNKKR |
| Ga0224510_105228322 | 3300022309 | Sediment | TIRTTMALAFLLFVFFIVVAMIALFIFPPTKWVQWFYNTDDKRE |
| Ga0209483_100012556 | 3300025862 | Arctic Peat Soil | MALAFLLFVFFVIIVLIGLFIFPPTKWVERFANKEKK |
| Ga0207692_101118003 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MALAVLLFVFFVIIVLIGLFVFPPTAWVKWFANDHKKK |
| Ga0207642_103897692 | 3300025899 | Miscanthus Rhizosphere | MKTRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK |
| Ga0207680_103642683 | 3300025903 | Switchgrass Rhizosphere | MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK |
| Ga0207685_102965921 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RWSDMALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDHKKR |
| Ga0207654_104353442 | 3300025911 | Corn Rhizosphere | MALAVLLFVFFIIIVLIGLFVFPPTKWVKWFASETKKK |
| Ga0207654_107218762 | 3300025911 | Corn Rhizosphere | MALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKK |
| Ga0207707_107834572 | 3300025912 | Corn Rhizosphere | METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK |
| Ga0207695_1000441110 | 3300025913 | Corn Rhizosphere | MALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK |
| Ga0207671_103689462 | 3300025914 | Corn Rhizosphere | MLSIRWRHMALAVLLFVFFVIVVLIGLFVFPPTKWVKWFANDNKKR |
| Ga0207693_114403902 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IEWRHMSLAVLLFVFFVIIVLITLFIFPPTKWVKWFANDNKKR |
| Ga0207649_103829241 | 3300025920 | Corn Rhizosphere | YAQYKMETRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK |
| Ga0207694_100215553 | 3300025924 | Corn Rhizosphere | MALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK |
| Ga0207694_116393942 | 3300025924 | Corn Rhizosphere | MALVVLLLVFFFIIVLITLFIFPPTKWVKWFHQQDKKK |
| Ga0207687_111399672 | 3300025927 | Miscanthus Rhizosphere | GDNMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK |
| Ga0207709_102686192 | 3300025935 | Miscanthus Rhizosphere | MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK |
| Ga0207709_103092903 | 3300025935 | Miscanthus Rhizosphere | MHMALVVLLFVFFIIVLLIAFFIFPPNKWVEWFVKKDKK |
| Ga0207689_100047442 | 3300025942 | Miscanthus Rhizosphere | MKTPMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDK |
| Ga0207667_1000077618 | 3300025949 | Corn Rhizosphere | MERHMALAVLLFVFFVIIVLIGLFIFPPTKWVQWFASQNKRK |
| Ga0207640_109324803 | 3300025981 | Corn Rhizosphere | KMERPMALAVLLFVFFVIIVLITLFIFPPTRWVRWFASKDKN |
| Ga0207703_102913413 | 3300026035 | Switchgrass Rhizosphere | MALAVLLFVFFCIIVLIGLFVFPPTKWVKWFANDDKKR |
| Ga0207676_105888432 | 3300026095 | Switchgrass Rhizosphere | MKTRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKKDKK |
| Ga0209178_10579302 | 3300027725 | Agricultural Soil | MKTPMALVVLLFVFFMIVVLIALFIFPPNKWVEWFVKKDKK |
| Ga0209579_107978682 | 3300027869 | Surface Soil | MALAVLLFVFFVIVVLIGLFVFPPTKWVEWFASQNRKK |
| Ga0209488_104809491 | 3300027903 | Vadose Zone Soil | MKTLMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKNDKK |
| Ga0268264_108399513 | 3300028381 | Switchgrass Rhizosphere | MALAVLLFVFFIIVLLIAFFIFPPNKWVEWFVNKEKKIEKK |
| Ga0265338_107278872 | 3300028800 | Rhizosphere | MALAVLLFVFFVIIALIGLFVFPPTKWVKWFANDNKKR |
| Ga0308309_102582352 | 3300028906 | Soil | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFVNKDKK |
| Ga0170824_1057180602 | 3300031231 | Forest Soil | METRMALAVLLFVFFIIVILIALFIFPPNKWVEWFVKSNKK |
| Ga0170824_1275817061 | 3300031231 | Forest Soil | RHMALAVLLFVFFIIVVLIALFIFPPNKWVEWFADKNKK |
| Ga0308175_1001709112 | 3300031938 | Soil | MALAVLLFVFFCIIVLIGLFVFPPTQWVKWFAKDDKKR |
| Ga0311301_103344853 | 3300032160 | Peatlands Soil | MRVMALAVLLFVFFVIIVLIGLFVFPPTRWVKWFANDNKKR |
| Ga0307471_1031957012 | 3300032180 | Hardwood Forest Soil | WRHMALAVLLFVFFIIVVLIALFIFPPNKWVEWFVNKDKK |
| Ga0326723_0228006_319_432 | 3300034090 | Peat Soil | MALAVLLFVFFIIVVLIALFIFPPNKWVEWFANKDKK |
| ⦗Top⦘ |