| Basic Information | |
|---|---|
| Family ID | F087802 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MAKFKPVRPKKAKTPQVQGGVPCLILIFSAMALVGIVMFLVLKYANG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.45 % |
| % of genes near scaffold ends (potentially truncated) | 21.82 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (14.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.67% β-sheet: 0.00% Coil/Unstructured: 65.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01138 | RNase_PH | 47.27 |
| PF03725 | RNase_PH_C | 18.18 |
| PF01725 | Ham1p_like | 6.36 |
| PF07690 | MFS_1 | 6.36 |
| PF00575 | S1 | 1.82 |
| PF04977 | DivIC | 1.82 |
| PF00312 | Ribosomal_S15 | 1.82 |
| PF08808 | RES | 0.91 |
| PF00486 | Trans_reg_C | 0.91 |
| PF03091 | CutA1 | 0.91 |
| PF13231 | PMT_2 | 0.91 |
| PF00326 | Peptidase_S9 | 0.91 |
| PF07586 | HXXSHH | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 65.45 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 65.45 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 65.45 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 6.36 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 1.82 |
| COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 1.82 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.91 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10003615 | All Organisms → cellular organisms → Bacteria | 11046 | Open in IMG/M |
| 3300004114|Ga0062593_102471648 | Not Available | 587 | Open in IMG/M |
| 3300004114|Ga0062593_103253769 | Not Available | 521 | Open in IMG/M |
| 3300004477|Ga0068971_1268286 | Not Available | 529 | Open in IMG/M |
| 3300005172|Ga0066683_10354489 | Not Available | 910 | Open in IMG/M |
| 3300005338|Ga0068868_100467078 | Not Available | 1100 | Open in IMG/M |
| 3300005434|Ga0070709_10691512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300005434|Ga0070709_10743272 | Not Available | 766 | Open in IMG/M |
| 3300005440|Ga0070705_100509585 | Not Available | 915 | Open in IMG/M |
| 3300005445|Ga0070708_100018242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5872 | Open in IMG/M |
| 3300005458|Ga0070681_10002851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 15976 | Open in IMG/M |
| 3300005471|Ga0070698_100708540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300005518|Ga0070699_100254391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1570 | Open in IMG/M |
| 3300005518|Ga0070699_102041747 | Not Available | 524 | Open in IMG/M |
| 3300005533|Ga0070734_10001716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30196 | Open in IMG/M |
| 3300005534|Ga0070735_10319646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 934 | Open in IMG/M |
| 3300005534|Ga0070735_10838282 | Not Available | 541 | Open in IMG/M |
| 3300005538|Ga0070731_10488174 | Not Available | 820 | Open in IMG/M |
| 3300005541|Ga0070733_10932722 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005542|Ga0070732_10099623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
| 3300005542|Ga0070732_10839823 | Not Available | 560 | Open in IMG/M |
| 3300005545|Ga0070695_101560502 | Not Available | 550 | Open in IMG/M |
| 3300005546|Ga0070696_101425631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005557|Ga0066704_10160717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1510 | Open in IMG/M |
| 3300005719|Ga0068861_100890104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 842 | Open in IMG/M |
| 3300005764|Ga0066903_103877971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300006059|Ga0075017_100646612 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006162|Ga0075030_100185417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1678 | Open in IMG/M |
| 3300006163|Ga0070715_10525091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 682 | Open in IMG/M |
| 3300006174|Ga0075014_100741486 | Not Available | 575 | Open in IMG/M |
| 3300006871|Ga0075434_100197744 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300009089|Ga0099828_10227684 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300009089|Ga0099828_11881938 | Not Available | 525 | Open in IMG/M |
| 3300009090|Ga0099827_12013643 | Not Available | 501 | Open in IMG/M |
| 3300010047|Ga0126382_10740149 | Not Available | 830 | Open in IMG/M |
| 3300010361|Ga0126378_13168981 | Not Available | 523 | Open in IMG/M |
| 3300010379|Ga0136449_100075058 | All Organisms → cellular organisms → Bacteria | 7197 | Open in IMG/M |
| 3300010379|Ga0136449_100221283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3561 | Open in IMG/M |
| 3300010379|Ga0136449_101121666 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300010379|Ga0136449_101323283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1121 | Open in IMG/M |
| 3300010379|Ga0136449_103830615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 565 | Open in IMG/M |
| 3300011269|Ga0137392_11535103 | Not Available | 525 | Open in IMG/M |
| 3300011270|Ga0137391_10235545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
| 3300012202|Ga0137363_11754918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300012203|Ga0137399_11144729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300012205|Ga0137362_10619565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300012918|Ga0137396_11253367 | Not Available | 518 | Open in IMG/M |
| 3300012955|Ga0164298_10366792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300012960|Ga0164301_11079776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300014638|Ga0181536_10009392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 9246 | Open in IMG/M |
| 3300014969|Ga0157376_13033466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 508 | Open in IMG/M |
| 3300017822|Ga0187802_10027741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1992 | Open in IMG/M |
| 3300017823|Ga0187818_10014406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3378 | Open in IMG/M |
| 3300017932|Ga0187814_10020857 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300017932|Ga0187814_10029586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
| 3300017943|Ga0187819_10047765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2539 | Open in IMG/M |
| 3300017955|Ga0187817_10720071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300017972|Ga0187781_10022051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4426 | Open in IMG/M |
| 3300017973|Ga0187780_10500010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 868 | Open in IMG/M |
| 3300017973|Ga0187780_10909336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300018034|Ga0187863_10674113 | Not Available | 583 | Open in IMG/M |
| 3300018086|Ga0187769_10700528 | Not Available | 766 | Open in IMG/M |
| 3300018433|Ga0066667_10575710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300020579|Ga0210407_10004819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10548 | Open in IMG/M |
| 3300021088|Ga0210404_10587533 | Not Available | 632 | Open in IMG/M |
| 3300021170|Ga0210400_10983978 | Not Available | 686 | Open in IMG/M |
| 3300021401|Ga0210393_11501146 | Not Available | 536 | Open in IMG/M |
| 3300021406|Ga0210386_10933649 | Not Available | 742 | Open in IMG/M |
| 3300021407|Ga0210383_11076887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300021420|Ga0210394_11509073 | Not Available | 568 | Open in IMG/M |
| 3300021432|Ga0210384_10819056 | Not Available | 829 | Open in IMG/M |
| 3300021433|Ga0210391_11358781 | Not Available | 547 | Open in IMG/M |
| 3300021476|Ga0187846_10311067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300024290|Ga0247667_1086564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300025906|Ga0207699_10391938 | Not Available | 988 | Open in IMG/M |
| 3300025912|Ga0207707_10013090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7227 | Open in IMG/M |
| 3300027497|Ga0208199_1000690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13030 | Open in IMG/M |
| 3300027826|Ga0209060_10001339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27780 | Open in IMG/M |
| 3300027842|Ga0209580_10019862 | All Organisms → cellular organisms → Bacteria | 2980 | Open in IMG/M |
| 3300027842|Ga0209580_10074181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
| 3300027842|Ga0209580_10227158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 927 | Open in IMG/M |
| 3300027869|Ga0209579_10316304 | Not Available | 842 | Open in IMG/M |
| 3300027875|Ga0209283_10599767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 698 | Open in IMG/M |
| 3300027898|Ga0209067_10890716 | Not Available | 522 | Open in IMG/M |
| 3300031715|Ga0307476_10043830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3028 | Open in IMG/M |
| 3300031716|Ga0310813_10359141 | Not Available | 1243 | Open in IMG/M |
| 3300031718|Ga0307474_11191156 | Not Available | 602 | Open in IMG/M |
| 3300031720|Ga0307469_11729921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031754|Ga0307475_11210626 | Not Available | 588 | Open in IMG/M |
| 3300031823|Ga0307478_11764434 | Not Available | 509 | Open in IMG/M |
| 3300031962|Ga0307479_10241612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1782 | Open in IMG/M |
| 3300032160|Ga0311301_10554836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300032160|Ga0311301_11768141 | Not Available | 739 | Open in IMG/M |
| 3300032160|Ga0311301_12738304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 541 | Open in IMG/M |
| 3300032770|Ga0335085_11073032 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032783|Ga0335079_10029552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6286 | Open in IMG/M |
| 3300032783|Ga0335079_10187532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2301 | Open in IMG/M |
| 3300032783|Ga0335079_10209986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2157 | Open in IMG/M |
| 3300032783|Ga0335079_10835600 | Not Available | 951 | Open in IMG/M |
| 3300032783|Ga0335079_11018914 | Not Available | 843 | Open in IMG/M |
| 3300032805|Ga0335078_10376783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1873 | Open in IMG/M |
| 3300032805|Ga0335078_11533705 | Not Available | 742 | Open in IMG/M |
| 3300032828|Ga0335080_10698754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300032828|Ga0335080_11143735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300032828|Ga0335080_12399212 | Not Available | 503 | Open in IMG/M |
| 3300032892|Ga0335081_10508922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1512 | Open in IMG/M |
| 3300032897|Ga0335071_11147102 | Not Available | 723 | Open in IMG/M |
| 3300032898|Ga0335072_10655475 | Not Available | 1040 | Open in IMG/M |
| 3300033004|Ga0335084_11323723 | Not Available | 716 | Open in IMG/M |
| 3300033158|Ga0335077_11188692 | Not Available | 747 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 10.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100036152 | 3300000567 | Peatlands Soil | MAKFKPVRPKKAKTPQVQGGLPCVILLFVGIAILFVVMFLVLKYANG* |
| Ga0062593_1024716482 | 3300004114 | Soil | GLSMAKFKPVRPKKEKVPQVQGGVPCLVLMFSAMVLVGIVMYLVLKYANG* |
| Ga0062593_1032537692 | 3300004114 | Soil | MAKFKPVRPKKAKTPQVQGGVPCLILVFAAMVMVFVVMYLVLKYASG* |
| Ga0068971_12682861 | 3300004477 | Peatlands Soil | HTAMAKFKPVRPKKAKTPQVQGGLPCVILLFVGIAILFVVMFLVLKYANG* |
| Ga0066683_103544891 | 3300005172 | Soil | MAKFKPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG* |
| Ga0068868_1004670782 | 3300005338 | Miscanthus Rhizosphere | MAKFKLAKPKKAKAPQVQGGLPCLILLFTAMVLVGILMFLVLKYANG* |
| Ga0070709_106915122 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKEKVPQVQGGVPCLIVMFSAMVLVGIVMYLVLKYANG* |
| Ga0070709_107432722 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKAKTPPVQGGLPCLIIIFLIMAVVFAVMFLVLKYANG* |
| Ga0070705_1005095851 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKAKTPQVQGGVPCLIVVFAAMVMVFVVMYLVLKYASG* |
| Ga0070708_1000182428 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKEKVPQVQGGVPCLVLMFSAMVLVGIVMYLVLKYANG* |
| Ga0070681_1000285115 | 3300005458 | Corn Rhizosphere | MAKFKLAKPKKAKAPRVQGGLPCLILLFTAMVLVGILMFLVLKYANG* |
| Ga0070698_1007085402 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKEKVPQLQGGVPCLVLMFSAMVLVGIVMYLVLKYANG* |
| Ga0070699_1002543911 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLSMAKFKPVRPKKEKVPQVQGGVPCLVLMFSAMVLVGIVMYLVLKYANG* |
| Ga0070699_1020417472 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRLKKAKAPQVQGGVPCLILIFSAMALVGIVMFLVLKYANG* |
| Ga0070734_1000171612 | 3300005533 | Surface Soil | MAKFKPVRPKKEKTPHVQGGLPCVILLFIGIAILFLVMYLVLKNAS* |
| Ga0070735_103196462 | 3300005534 | Surface Soil | MAKFKPVRPKKDKTPQVQGGLPCIILLISAMVFVCVVMYLVLKYANG* |
| Ga0070735_108382822 | 3300005534 | Surface Soil | MAKFKPVRPKKDKTPQVQGGLPCIILIFVGIAILFVVMYLVLKYANG* |
| Ga0070731_104881742 | 3300005538 | Surface Soil | MAKFKPVRPKKEKTPQVQGGVPCLILLFSAMILVCIVMYLVLKYANG* |
| Ga0070733_109327221 | 3300005541 | Surface Soil | MAKFKPVRPKKDKTPQVQGGLPCIILIFVGIAILFVVMYLVLK |
| Ga0070732_100996232 | 3300005542 | Surface Soil | MAKFKPVRPKKAKTPPVQGGLPCLILLFLVMVLVGVVMFLVLKYANG* |
| Ga0070732_108398231 | 3300005542 | Surface Soil | MAKFKPVRPKKAKAPQVQGGVPCLILIFSAMVLVGVVMFLVLKYANG* |
| Ga0070695_1015605022 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKLAKPKKAKTPQVQGGVPCLILMFSGMVLVGILMFLVLKYANG* |
| Ga0070696_1014256312 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVKPKKAKTPQVQGGVPCLILVFTAMVMVFVVMYLVLKYAGG* |
| Ga0066704_101607173 | 3300005557 | Soil | MAKFKPVRPKKEKVPQVQGGVPCLILMFSAMVLVGVVMYLVLKYANG* |
| Ga0068861_1008901041 | 3300005719 | Switchgrass Rhizosphere | SSMAKFKLAKPKKAKTPQVQGGVPCLILMFSGMVLVGILMFLVLKYANG* |
| Ga0066903_1038779712 | 3300005764 | Tropical Forest Soil | MAKFRPVRPKKEKAPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG* |
| Ga0075017_1006466122 | 3300006059 | Watersheds | MAKFKPVRPKKAKAPQVQGGVPCLILIFSVMALVGLVMFLVLKYANG* |
| Ga0075030_1001854174 | 3300006162 | Watersheds | LAGHSMAKFKPVRPKKAKAPQVQGGVPCLILIFSAMALVGIVMFLVLKYANG* |
| Ga0070715_105250912 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKEKVPQVQGGVPCLILMFAAMVLVGIVMYLVLKYANG* |
| Ga0075014_1007414861 | 3300006174 | Watersheds | MAKFKPVRPKKAKAPQVQGGVPCLILIFSAMALVGIVMFLVLKYANG* |
| Ga0075434_1001977442 | 3300006871 | Populus Rhizosphere | MAKFRPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG* |
| Ga0099828_102276842 | 3300009089 | Vadose Zone Soil | MAKFKPVRPKKAKTPQVQGGVPCLILIFSAMALVGIVMFLVLKYANG* |
| Ga0099828_118819381 | 3300009089 | Vadose Zone Soil | MAKFKPVRPKKAKTPPVQGGIPCLVAMVIAMMILFLVMYLVLKYANE* |
| Ga0099827_120136431 | 3300009090 | Vadose Zone Soil | MAKFKPVRPKKDKVPQVQGGVPCLILMFSAMVLVGIVIYLVLKYANG* |
| Ga0126382_107401491 | 3300010047 | Tropical Forest Soil | PVRPKKEKAPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG* |
| Ga0126378_131689812 | 3300010361 | Tropical Forest Soil | MAKFKPIRPKKEKAPPVQGGVPCLILLIAGIVAVCILMFLVLKYAGG* |
| Ga0136449_1000750587 | 3300010379 | Peatlands Soil | MAKFKPVRPKKAKAPQVQGGVPCLILIFSVMAIVGLVMFLVLKYANG* |
| Ga0136449_1002212834 | 3300010379 | Peatlands Soil | VRPKKDKTPQVQGGLPCVILLFVGIAVLFVVMFLVLKYANG* |
| Ga0136449_1011216662 | 3300010379 | Peatlands Soil | MAKFKPVRPKKDKAPQVQGGVPCLILLFSAMVLVGIVMFLVLKYANG* |
| Ga0136449_1013232831 | 3300010379 | Peatlands Soil | MAKFKPVRPKKEKAPQVQGGVPCLILLFSARVLVGVVMFLVLKYANG* |
| Ga0136449_1038306152 | 3300010379 | Peatlands Soil | MAKFKPVRPKKQKAPQVQGGVPCLILLFSAMVLVGVVMFLVLKYANG* |
| Ga0137392_115351032 | 3300011269 | Vadose Zone Soil | MAKFKLAKPKKAKTPQVQGGVPCLILMFSAMVLVGILMFLVLKYANG* |
| Ga0137391_102355452 | 3300011270 | Vadose Zone Soil | MAKFKPVRPKKDKVPQVQGGFPCLILMFSAMVLVGIVMYLVLKYANG* |
| Ga0137363_117549182 | 3300012202 | Vadose Zone Soil | MAKFKPVRPKKDKVPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG* |
| Ga0137399_111447292 | 3300012203 | Vadose Zone Soil | MAKFKPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLV |
| Ga0137362_106195652 | 3300012205 | Vadose Zone Soil | MAKFRPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVLKYAD |
| Ga0137396_112533672 | 3300012918 | Vadose Zone Soil | MAKFKPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVL* |
| Ga0164298_103667922 | 3300012955 | Soil | MAKFKLAKPKKAKAPQVQGGLPSFILLFTAIGLVGILMFL* |
| Ga0164301_110797762 | 3300012960 | Soil | MAKFKPVRPKKEKVPQVQGGVPCLVLMFTAMVLVGIVMYLVLKYANG* |
| Ga0181536_100093923 | 3300014638 | Bog | MAKFKPVRPKKTKAPQVQGGVPCLILLFSAMLLVGVVMFLVLKYANG* |
| Ga0157376_130334662 | 3300014969 | Miscanthus Rhizosphere | MAKFKLAKPKKAKAPQVQGGLPCLILLFTGMVLVGILMFLVLKYANG* |
| Ga0187802_100277413 | 3300017822 | Freshwater Sediment | MAKFKPVRPKKAKTPPVQGGIPCLIVIFSVMVLVGIVMFLVLKYANG |
| Ga0187818_100144064 | 3300017823 | Freshwater Sediment | MAKFKPVRPKKAKKPPVQGGIPCLIVIFSVMVLVGIVMFLVLKYANG |
| Ga0187814_100208572 | 3300017932 | Freshwater Sediment | MAKFKPVRPKKAKKPPVQGGIPCLIVIFSVMVLVGLVMFLVLKYANG |
| Ga0187814_100295864 | 3300017932 | Freshwater Sediment | LAGRSMAKFKPVRPKKAKTPPVQGGIPCLIVIFSVMVLVGIVMFLVLKYANG |
| Ga0187819_100477653 | 3300017943 | Freshwater Sediment | MAKFKPVRPKKAKTSPVQGGIPCLILIFSALVVVGLVMFLVLKYANG |
| Ga0187817_107200711 | 3300017955 | Freshwater Sediment | MAKFKPVRPKKAKTSPVQGGIPCLILIFSAMVVVGLVMFLVLKYANG |
| Ga0187781_100220515 | 3300017972 | Tropical Peatland | MAKFKPVRPKKAKTPQVQGGWPCIILLISAMVLVCVVMYLVLKYANG |
| Ga0187780_105000102 | 3300017973 | Tropical Peatland | MAKFKPVRPKKAKTPQVQGGWPCIILLLSAMVLVCVVMYLVLKYANG |
| Ga0187780_109093362 | 3300017973 | Tropical Peatland | MAKFKPVRPKKAKTPPVQGGIPCLVLIFSVMALVGLVMFMVLKYANG |
| Ga0187863_106741132 | 3300018034 | Peatland | MAKFKPVRPKKHKTPQVQGGLPCVILLFVGIAVLFVVMFLVLKYANG |
| Ga0187769_107005282 | 3300018086 | Tropical Peatland | MAKFKPIRPKKAKTPQVQGGWPCIILLLSAMVLVCVVMYLVLKYANG |
| Ga0066667_105757102 | 3300018433 | Grasslands Soil | MAKFKPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG |
| Ga0210407_100048195 | 3300020579 | Soil | MAKFKPVRPKKAKAPQVQGGIPCLILIFSAMALVGIVMFLVLKYANG |
| Ga0210404_105875331 | 3300021088 | Soil | ADHRMAKFKPVRPKKAKAPQVQGGIPCLILIFSAMALVGIVMFLVLKYANG |
| Ga0210400_109839782 | 3300021170 | Soil | WPALADHRMAKFKPVRPKKAKAPQVQGGIPCLILIFSAMALVGIVMFLVLKYANG |
| Ga0210393_115011462 | 3300021401 | Soil | MAKFKPVRPKKDKTPQVQGGVPCLILLFSAMVLVGVVMFLVLKYANG |
| Ga0210386_109336492 | 3300021406 | Soil | KPVRPKKAKAPQVQGGIPCLILIFSAMALVGIVMFLVLKYANG |
| Ga0210383_110768872 | 3300021407 | Soil | MAKFKPVRPKKDKTPQVQGGLPCIILIFVGIAILFVVMY |
| Ga0210394_115090732 | 3300021420 | Soil | MAKFKPVRPKKAKAPQVQGGIPCLILIFSAMAVVGIVMFLVLKYANG |
| Ga0210384_108190562 | 3300021432 | Soil | MAKFKPIRPKKKTTPQVQGGLPCVILLFVGIAVLFVVMYLVLKYANG |
| Ga0210391_113587812 | 3300021433 | Soil | MAKFKPVRPKKDKTPQVQGGLPCIILIFVGIAILFVVMYLVLKYANG |
| Ga0187846_103110672 | 3300021476 | Biofilm | MAKFKPVRPKKTKTPQVQGGVPCLILIFAVMALVFVVMFLVLKYANG |
| Ga0247667_10865641 | 3300024290 | Soil | MAKFRPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVLK |
| Ga0207699_103919382 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKKEKVPQVQGGVPCLIVMFSAMVLVGIVMYLVLKYANG |
| Ga0207707_100130902 | 3300025912 | Corn Rhizosphere | MAKFKLAKPKKAKAPRVQGGLPCLILLFTAMVLVGILMFLVLKYANG |
| Ga0208199_100069014 | 3300027497 | Peatlands Soil | MAKFKPVRPKKAKTPQVQGGLPCVILLFVGIAILFVVMFLVLKYANG |
| Ga0209060_1000133912 | 3300027826 | Surface Soil | MAKFKPVRPKKEKTPHVQGGLPCVILLFIGIAILFLVMYLVLKNAS |
| Ga0209580_100198622 | 3300027842 | Surface Soil | MAKFKPVRPKKAKAPQVQGGVPCLILIFSAMVLVGVVMFLVLKYANG |
| Ga0209580_100741812 | 3300027842 | Surface Soil | MAKFKPVRPKKAKTPPVQGGLPCLILLFLVMVLVGVVMFLVLKYANG |
| Ga0209580_102271582 | 3300027842 | Surface Soil | MAKFKPVRPKKDKTPQVQGGLPCIILLISAMVFVCVVMYLVLKYANG |
| Ga0209579_103163042 | 3300027869 | Surface Soil | MAKFKPVRPKKEKTPQVQGGVPCLILLFSAMILVCIVMYLVLKYANG |
| Ga0209283_105997672 | 3300027875 | Vadose Zone Soil | MAKFKPVRPKKAKTPQVQGGVPCLILIFSAMALVGIVMFLVLKYANG |
| Ga0209067_108907161 | 3300027898 | Watersheds | MAKFKPVRPKKAKAPQVQGGVPCLILIFSVMALVGLVMFLVLKYANG |
| Ga0307476_100438305 | 3300031715 | Hardwood Forest Soil | MAKFKPVRPKKEKTPQVQGGVPCLILLFSAMLLVGIVMFLVLKYANG |
| Ga0310813_103591412 | 3300031716 | Soil | MAKFKPVRPKKEKVPQVQGGVPCLVLMFTAMVLVGIVMYLVLKYANG |
| Ga0307474_111911561 | 3300031718 | Hardwood Forest Soil | KEKTPQVQGGVPCLILLFSAMLLVGIVMFLVLKYANG |
| Ga0307469_117299212 | 3300031720 | Hardwood Forest Soil | MAKFRPVRPKKEKVPQVQGGVPCLILMFSAMVLVGIVMYLVLKYANG |
| Ga0307475_112106262 | 3300031754 | Hardwood Forest Soil | MAKFKPVRPKKAKTPQVQGGVPCLILIFSVMVLVGVVMFLVLKYANG |
| Ga0307478_117644342 | 3300031823 | Hardwood Forest Soil | MAKFKPVRPKKEKTPQVQGGVPCLILLFSAMVLVGIVMFLVLKYANG |
| Ga0307479_102416123 | 3300031962 | Hardwood Forest Soil | MAKFKPVRPKKAKTPPVQGGLPCLIIIFLVMALVFAVMFLVLKYANG |
| Ga0311301_105548362 | 3300032160 | Peatlands Soil | MRGPSMAKFKPVRPKKDKAPQVQGGVPCLILLFSAMVLVGIVMFLVLKYANG |
| Ga0311301_117681412 | 3300032160 | Peatlands Soil | MAKFKPVRPKKAKAPQVQCGVPCLILIFSVMAIVGLVMFLVLKYANG |
| Ga0311301_127383041 | 3300032160 | Peatlands Soil | ARGPSMAKFKPVRPKKQKAPQVQGGVPCLILLFSAMVLVGVVMFLVLKYANG |
| Ga0335085_110730322 | 3300032770 | Soil | MAKFKPIRPKKDKTPQVQGGLPCIILLLFAMVLVCVVMYLVLKYANG |
| Ga0335079_100295523 | 3300032783 | Soil | MAKFKPIRPKKGKTPQVQGGLPCVILLFVGIAILFVVMYLVLKYANG |
| Ga0335079_101875324 | 3300032783 | Soil | MAKFKPVRPKKAKTPPVQGGIPCLILIFSVMVLVFLVMFLVLKYANG |
| Ga0335079_102099862 | 3300032783 | Soil | MAKFKPVRPKKSKTPQVQGGLPCVILVFVGIAILFVLMYLVVKYANG |
| Ga0335079_108356001 | 3300032783 | Soil | MAKFKPVRPKKAKTPPVQGGIPCLILVFSVMALVGIVMFLVLKYANG |
| Ga0335079_110189142 | 3300032783 | Soil | MAKFKPVRPKKAKAPQVQGGVPCLILIFSAMALVGLVMFLVLKYANG |
| Ga0335078_103767833 | 3300032805 | Soil | MAKFKPVRPKKSKTPQVQGGLPCVILVFVGIAILFVMMYLVLKYANG |
| Ga0335078_115337052 | 3300032805 | Soil | MAKFKPVRPKKGKTPQVQGGLPCVILLFVGIAILFVVMYLVLKYANG |
| Ga0335080_106987543 | 3300032828 | Soil | ATIRSWPALVPMAKFKPVRPKKDKTPQVQGGLPCVILVFVGIALLFLVMYLVLKNANG |
| Ga0335080_111437351 | 3300032828 | Soil | MAKFKPVRPKKEKTPQVQGGLPCVILLFVGIAILFVVMFLVLKY |
| Ga0335080_123992121 | 3300032828 | Soil | MAKFKPVRPKKTKAPQVQGGLPCLILIFLAMALVGLVMFLVLKYANG |
| Ga0335081_105089223 | 3300032892 | Soil | PATIRSWPARACLSMAKFKPVRPKKSKTPQVQGGLPCVILVFVGIAILFVLMYLVVKYAN |
| Ga0335071_111471022 | 3300032897 | Soil | MAKFKPVRPKKAKTPTVQGGIPCLILVFSVMALVGIVMFLVLKYANG |
| Ga0335072_106554752 | 3300032898 | Soil | MAKFKPIRPKKDKTPHVQGGLPCVILLFVGIALLFLMMFLVLKYANG |
| Ga0335084_113237231 | 3300033004 | Soil | RPKKAKAPQVQGGVPCLILIFSVMALVGLVMFLVLKYANG |
| Ga0335077_111886921 | 3300033158 | Soil | AKTPPVQGGIPCLIVIFSVMVLVGIVMFLVLKYANG |
| ⦗Top⦘ |