Basic Information | |
---|---|
Family ID | F087795 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 41 residues |
Representative Sequence | SRPDLAQGTPVHAYLPPDALRVLAGAAGEVPLAEDEHLVAS |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.91 % |
% of genes near scaffold ends (potentially truncated) | 99.09 % |
% of genes from short scaffolds (< 2000 bps) | 97.27 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (70.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.182 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.49% β-sheet: 0.00% Coil/Unstructured: 85.51% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF08240 | ADH_N | 59.09 |
PF01636 | APH | 3.64 |
PF13305 | TetR_C_33 | 1.82 |
PF13669 | Glyoxalase_4 | 1.82 |
PF00378 | ECH_1 | 1.82 |
PF00027 | cNMP_binding | 0.91 |
PF13977 | TetR_C_6 | 0.91 |
PF13847 | Methyltransf_31 | 0.91 |
PF13360 | PQQ_2 | 0.91 |
PF13751 | DDE_Tnp_1_6 | 0.91 |
PF02661 | Fic | 0.91 |
PF12706 | Lactamase_B_2 | 0.91 |
PF00903 | Glyoxalase | 0.91 |
PF03136 | Pup_ligase | 0.91 |
PF12840 | HTH_20 | 0.91 |
PF00753 | Lactamase_B | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 70.00 % |
All Organisms | root | All Organisms | 30.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004615|Ga0068926_1370643 | Not Available | 780 | Open in IMG/M |
3300005329|Ga0070683_101977275 | Not Available | 560 | Open in IMG/M |
3300005406|Ga0070703_10321372 | Not Available | 652 | Open in IMG/M |
3300005436|Ga0070713_100396956 | Not Available | 1287 | Open in IMG/M |
3300005543|Ga0070672_100553624 | Not Available | 999 | Open in IMG/M |
3300005545|Ga0070695_101710258 | Not Available | 527 | Open in IMG/M |
3300006028|Ga0070717_10823158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 845 | Open in IMG/M |
3300006028|Ga0070717_11123121 | Not Available | 716 | Open in IMG/M |
3300006028|Ga0070717_11969111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
3300006034|Ga0066656_10907920 | Not Available | 564 | Open in IMG/M |
3300006052|Ga0075029_101221001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300006102|Ga0075015_100551634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300006162|Ga0075030_100757750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
3300006163|Ga0070715_10695843 | Not Available | 606 | Open in IMG/M |
3300006173|Ga0070716_100216138 | Not Available | 1284 | Open in IMG/M |
3300006914|Ga0075436_100959559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 641 | Open in IMG/M |
3300007076|Ga0075435_101061906 | Not Available | 708 | Open in IMG/M |
3300009098|Ga0105245_12410025 | Not Available | 580 | Open in IMG/M |
3300009520|Ga0116214_1108143 | Not Available | 1024 | Open in IMG/M |
3300010376|Ga0126381_104087872 | Not Available | 567 | Open in IMG/M |
3300010397|Ga0134124_11471820 | Not Available | 708 | Open in IMG/M |
3300010401|Ga0134121_12806915 | Not Available | 533 | Open in IMG/M |
3300010876|Ga0126361_10240013 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
3300012206|Ga0137380_11601618 | Not Available | 535 | Open in IMG/M |
3300012285|Ga0137370_10173881 | Not Available | 1255 | Open in IMG/M |
3300012351|Ga0137386_10937841 | Not Available | 618 | Open in IMG/M |
3300012351|Ga0137386_11232402 | Not Available | 522 | Open in IMG/M |
3300012469|Ga0150984_108257326 | Not Available | 522 | Open in IMG/M |
3300012519|Ga0157352_1056429 | Not Available | 600 | Open in IMG/M |
3300012930|Ga0137407_11971520 | Not Available | 557 | Open in IMG/M |
3300012960|Ga0164301_10812834 | Not Available | 716 | Open in IMG/M |
3300016319|Ga0182033_11965803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 532 | Open in IMG/M |
3300016445|Ga0182038_11131301 | Not Available | 696 | Open in IMG/M |
3300017924|Ga0187820_1217391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
3300017947|Ga0187785_10059230 | Not Available | 1453 | Open in IMG/M |
3300017955|Ga0187817_10879922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
3300017959|Ga0187779_10103779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1715 | Open in IMG/M |
3300017970|Ga0187783_10252527 | Not Available | 1289 | Open in IMG/M |
3300017972|Ga0187781_10658481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
3300017973|Ga0187780_10481070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
3300017974|Ga0187777_10735610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300017974|Ga0187777_11306284 | Not Available | 533 | Open in IMG/M |
3300017994|Ga0187822_10210324 | Not Available | 652 | Open in IMG/M |
3300018043|Ga0187887_10587633 | Not Available | 657 | Open in IMG/M |
3300018085|Ga0187772_10470847 | Not Available | 883 | Open in IMG/M |
3300018086|Ga0187769_10954337 | Not Available | 649 | Open in IMG/M |
3300020582|Ga0210395_10484564 | Not Available | 930 | Open in IMG/M |
3300021178|Ga0210408_10999304 | Not Available | 647 | Open in IMG/M |
3300021401|Ga0210393_10284112 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300021403|Ga0210397_10891960 | Not Available | 688 | Open in IMG/M |
3300021406|Ga0210386_11797030 | Not Available | 504 | Open in IMG/M |
3300021477|Ga0210398_10334326 | Not Available | 1235 | Open in IMG/M |
3300021560|Ga0126371_11972718 | Not Available | 702 | Open in IMG/M |
3300022720|Ga0242672_1142623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300024225|Ga0224572_1042677 | Not Available | 853 | Open in IMG/M |
3300024227|Ga0228598_1066262 | Not Available | 721 | Open in IMG/M |
3300025885|Ga0207653_10061902 | Not Available | 1264 | Open in IMG/M |
3300025903|Ga0207680_10374960 | Not Available | 1002 | Open in IMG/M |
3300025921|Ga0207652_11245175 | Not Available | 646 | Open in IMG/M |
3300025941|Ga0207711_11521668 | Not Available | 612 | Open in IMG/M |
3300027765|Ga0209073_10191478 | Not Available | 774 | Open in IMG/M |
3300027783|Ga0209448_10159887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
3300027817|Ga0209112_10120664 | Not Available | 861 | Open in IMG/M |
3300027826|Ga0209060_10105676 | Not Available | 1316 | Open in IMG/M |
3300027869|Ga0209579_10178464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1136 | Open in IMG/M |
3300028768|Ga0307280_10340329 | Not Available | 552 | Open in IMG/M |
3300028789|Ga0302232_10471607 | Not Available | 617 | Open in IMG/M |
3300028885|Ga0307304_10248904 | Not Available | 773 | Open in IMG/M |
3300029944|Ga0311352_11055980 | Not Available | 623 | Open in IMG/M |
3300030056|Ga0302181_10249178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 804 | Open in IMG/M |
3300030520|Ga0311372_10512777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1755 | Open in IMG/M |
3300030617|Ga0311356_11225860 | Not Available | 689 | Open in IMG/M |
3300030618|Ga0311354_11972058 | Not Available | 503 | Open in IMG/M |
3300031234|Ga0302325_10088556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5872 | Open in IMG/M |
3300031234|Ga0302325_11464258 | Not Available | 883 | Open in IMG/M |
3300031236|Ga0302324_103401988 | Not Available | 518 | Open in IMG/M |
3300031549|Ga0318571_10152758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
3300031549|Ga0318571_10297525 | Not Available | 606 | Open in IMG/M |
3300031549|Ga0318571_10450210 | Not Available | 511 | Open in IMG/M |
3300031668|Ga0318542_10236701 | Not Available | 927 | Open in IMG/M |
3300031679|Ga0318561_10150561 | Not Available | 1248 | Open in IMG/M |
3300031708|Ga0310686_115418520 | Not Available | 522 | Open in IMG/M |
3300031713|Ga0318496_10822686 | Not Available | 512 | Open in IMG/M |
3300031718|Ga0307474_10576408 | Not Available | 886 | Open in IMG/M |
3300031751|Ga0318494_10581382 | Not Available | 654 | Open in IMG/M |
3300031770|Ga0318521_10315317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
3300031778|Ga0318498_10176520 | Not Available | 971 | Open in IMG/M |
3300031778|Ga0318498_10350685 | Not Available | 659 | Open in IMG/M |
3300031821|Ga0318567_10857262 | Not Available | 514 | Open in IMG/M |
3300031845|Ga0318511_10232680 | Not Available | 824 | Open in IMG/M |
3300031845|Ga0318511_10578242 | Not Available | 523 | Open in IMG/M |
3300031938|Ga0308175_100494316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1299 | Open in IMG/M |
3300031959|Ga0318530_10369075 | Not Available | 595 | Open in IMG/M |
3300032009|Ga0318563_10518362 | Not Available | 644 | Open in IMG/M |
3300032043|Ga0318556_10123293 | Not Available | 1326 | Open in IMG/M |
3300032067|Ga0318524_10495142 | Not Available | 641 | Open in IMG/M |
3300032089|Ga0318525_10181296 | Not Available | 1082 | Open in IMG/M |
3300032089|Ga0318525_10251468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 908 | Open in IMG/M |
3300032160|Ga0311301_10050189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9582 | Open in IMG/M |
3300032261|Ga0306920_102822152 | Not Available | 661 | Open in IMG/M |
3300032515|Ga0348332_10156388 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300032805|Ga0335078_12593553 | Not Available | 520 | Open in IMG/M |
3300032828|Ga0335080_10758329 | Not Available | 1006 | Open in IMG/M |
3300032893|Ga0335069_10496836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
3300032955|Ga0335076_11648406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
3300033289|Ga0310914_10089591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2625 | Open in IMG/M |
3300033289|Ga0310914_10276289 | Not Available | 1513 | Open in IMG/M |
3300033289|Ga0310914_10389938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1260 | Open in IMG/M |
3300033289|Ga0310914_10963826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 753 | Open in IMG/M |
3300033290|Ga0318519_10508692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 726 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.18% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.18% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.18% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.64% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.73% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.82% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068926_13706431 | 3300004615 | Peatlands Soil | PDLTQGTPVHCYLPPDALRVLADSPQEVPVPADEPLVAS* |
Ga0070683_1019772753 | 3300005329 | Corn Rhizosphere | RPDLAQGTPVHCYLPPEALRVLAGAAGEVPVAEDEHLVAS* |
Ga0070703_103213722 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ALMQNDGSRADLAQGTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS* |
Ga0070713_1003969561 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PDLAQGTPVNVYLPPDALRVLAGAAGEVPVAEDKPLVAS* |
Ga0070672_1005536241 | 3300005543 | Miscanthus Rhizosphere | AQGTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS* |
Ga0070695_1017102582 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQGTPVHVYLPPDALRVLAGAAGEVPLAEAEDEPLVAS* |
Ga0070717_108231581 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PDLAQGTPVHAYLPPDALRVLAGSTAEVPVPEDEPLLAS* |
Ga0070717_111231211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DLAQGTPVHAYLPPDALRVLAGSAAEVPVPEDEPLVAS* |
Ga0070717_119691112 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AQGTPVHCYLPPEALRVLAGAAGEVPVAEDEHLVAS* |
Ga0066656_109079201 | 3300006034 | Soil | GSRPELTQGTPVHAYLPPDALRVLAGAAGEVPLAEDEHLVAS* |
Ga0075029_1012210012 | 3300006052 | Watersheds | GTPVHCYLPPDALRVLAGSAQEVPVPADEPLVAS* |
Ga0075015_1005516343 | 3300006102 | Watersheds | LAQGTPVHCYLPPDALRVLAGSAQEVPVPADEPLVAS* |
Ga0075030_1007577502 | 3300006162 | Watersheds | QGTPVHCYLPPDALRVLAGSAQEVPVPADEPLVAS* |
Ga0070715_106958432 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QGTPVHVYLPPDALRVLAGAQDVPVAEEEPLVAS* |
Ga0070716_1002161383 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQGTPVHVYLPPDALRVLAGAAGEVPLAEDEHLVAS* |
Ga0075436_1009595592 | 3300006914 | Populus Rhizosphere | LAQGTPVHCYLPPDALRVLAGAAGEVPVAEDEHLVAS* |
Ga0075435_1010619062 | 3300007076 | Populus Rhizosphere | QGTPVHVYLPPDALRVLAGAAGEVPLAEDEHLVAS* |
Ga0105245_124100252 | 3300009098 | Miscanthus Rhizosphere | DGSRPDLAQGTPVHVYLPPDALRVLAGAAGEVPLAEAEDEPLVAS* |
Ga0116214_11081431 | 3300009520 | Peatlands Soil | GTPVHAYLPPDALRVLAGARGVVPAPAEEPLVTS* |
Ga0126381_1040878722 | 3300010376 | Tropical Forest Soil | ALAQGTPVHVYLPPDALRVLSGAAGEVPVAAEEEGPLVAT* |
Ga0134124_114718202 | 3300010397 | Terrestrial Soil | TPVHVYLPPDALRVLAGAAGEVPLAEAEDEPLVAS* |
Ga0134121_128069151 | 3300010401 | Terrestrial Soil | RPDLAQGIPVHVYLPPDALRVLAGAQDVPVPEEEPLVAS* |
Ga0126361_102400133 | 3300010876 | Boreal Forest Soil | PDLAQGTPVHCYLPPDALRVLAGAAREVPVPADEPLVAS* |
Ga0137380_116016181 | 3300012206 | Vadose Zone Soil | DGVRPDLTQGTPVHVFLPPEALRVLAGAQDVPVPEEEPLVAT* |
Ga0137370_101738811 | 3300012285 | Vadose Zone Soil | NDGSRPDLAQGTPVHVYLPPDALRVLAGAAGEVPLAEDEHLVAS* |
Ga0137386_109378411 | 3300012351 | Vadose Zone Soil | DGSRPDLAQGTPVHAYLPPDALRVLAGAAGEVPVAEDEPLVAS* |
Ga0137386_112324022 | 3300012351 | Vadose Zone Soil | QNDGARPDLTQGTPVHVFLPPDALRVLAGAQDVPVAEEEPLVAS* |
Ga0150984_1082573261 | 3300012469 | Avena Fatua Rhizosphere | NDGSHPDLSQGTPVHCYLPPDALRVLAGAAGEVPVAEEEPLVAS* |
Ga0157352_10564291 | 3300012519 | Unplanted Soil | GTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS* |
Ga0137407_119715202 | 3300012930 | Vadose Zone Soil | RPELAQGTPVHAYLPPDALRVLAGAAGEVPLAEDEHLVAS* |
Ga0164301_108128341 | 3300012960 | Soil | ALMQNDGSRADLAQVTPVNVYRPPDALRVLAGAAGDVPLAEDEHLVAS* |
Ga0182033_119658031 | 3300016319 | Soil | GTQLDLASGTPVHCYLPPDALRVLAGAHDVPIAADEPLVAT |
Ga0182038_111313012 | 3300016445 | Soil | PLQAQMQNDGGQLDLAHGTPVLCYLPPDALRVLAGARGVVPAPVEEPLVAS |
Ga0187820_12173912 | 3300017924 | Freshwater Sediment | LAQGTPVHVYFPPDALRVLAGAAGEVPVAEDEPLVAT |
Ga0187785_100592303 | 3300017947 | Tropical Peatland | PDLTQGTPVNVYLPPDALRVLAGAAGEVPLAEDEHLVAS |
Ga0187817_108799222 | 3300017955 | Freshwater Sediment | RPDLTQGTPVHAYLPPDALRVLADSPREVPVPADEPLAAS |
Ga0187779_101037791 | 3300017959 | Tropical Peatland | GASLQALVQNDGEQLDLAPGTPVHCYLPPEALRVLAGAHDVPIAADEPLVAT |
Ga0187783_102525271 | 3300017970 | Tropical Peatland | GEHTDLAQGTPVHAYLPPDALRVLAGAAGEVPVAEDEPLVAT |
Ga0187781_106584811 | 3300017972 | Tropical Peatland | QLDLAQGTPVHCYLPPDALRVLAGAQDVPVPAEEPLVAT |
Ga0187780_104810701 | 3300017973 | Tropical Peatland | QLDLAQGTPVLCYLPPEALRVLAGAQDVPVPAEEPLVAT |
Ga0187777_107356101 | 3300017974 | Tropical Peatland | QRPDLAQGTPVQVYLPPDALRVLAGSRDVPVPAEEPLVAG |
Ga0187777_113062841 | 3300017974 | Tropical Peatland | HPDLAQGTPVHCYLPPDALRVLAGERADVPISADEPLVSR |
Ga0187822_102103242 | 3300017994 | Freshwater Sediment | DLAQGTPVHCYLPPDALRVLAGAHDVAIPADEPLVAT |
Ga0187887_105876332 | 3300018043 | Peatland | GERPDLTQGTPVHAHLPAEALRVLADAAGSVPVPADEPLVAS |
Ga0187772_104708472 | 3300018085 | Tropical Peatland | NDGSRPDLAQGTPVNCYLPSDALRVLAGSADKALVPEDEPLVAS |
Ga0187769_109543372 | 3300018086 | Tropical Peatland | GEHPDLAQGTPVHAYLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0210395_104845641 | 3300020582 | Soil | NDGAPPDLTQGTPVHCYLPPDALRVLAGAAGEVPVAEDEPLVAT |
Ga0210408_109993042 | 3300021178 | Soil | IQNDGDSPPLAQGTPVHVYLPPDGLRVLSGAAGEVPVAAEEGPLVAT |
Ga0210393_102841123 | 3300021401 | Soil | NDGERPDLTQGTPVHCYLPPDALRVLAGAAGEVPVAEDEPLVAT |
Ga0210397_108919602 | 3300021403 | Soil | QGTAVHAYLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0210386_117970302 | 3300021406 | Soil | DGEHPDLAQGTPVHAYLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0210398_103343261 | 3300021477 | Soil | HPDLAPGTPVHAYLPPDALRVLAGARGVVPVAAEEPLVAS |
Ga0126371_119727182 | 3300021560 | Tropical Forest Soil | SRPELTQGTPVHCYLPPDALRVLAGAAGEVPVAEDEHLVAT |
Ga0242672_11426231 | 3300022720 | Soil | SRPDLAQGTPVNVYLPPDALRVLAGSAGEVPIAEDEPLVAS |
Ga0224572_10426771 | 3300024225 | Rhizosphere | ERPDLTQGTPVHAHLPAEALRVLAGAAGSVPVAADEPLVAS |
Ga0228598_10662622 | 3300024227 | Rhizosphere | TQGTPVHAYLPPDALRVLAGARGVVPAPEEEPLVAS |
Ga0207653_100619022 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ALMQNDGSRADLAQGTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS |
Ga0207680_103749601 | 3300025903 | Switchgrass Rhizosphere | LMQNDGSRADLAQGTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS |
Ga0207652_112451752 | 3300025921 | Corn Rhizosphere | DGSRADLAQGTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS |
Ga0207711_115216681 | 3300025941 | Switchgrass Rhizosphere | QNDGSRADLAQGTPVNVYLPPDALRVLAGAAGDVPLAEDEHLVAS |
Ga0209073_101914782 | 3300027765 | Agricultural Soil | DGSRPDLAQGTPVHCYLPPDALRVLAGAAGEVPVAEDEHLVAS |
Ga0209448_101598871 | 3300027783 | Bog Forest Soil | DGERPELTRGTPVHCYLPPDALRVLAGSAQEVPVPADEPLVAS |
Ga0209112_101206641 | 3300027817 | Forest Soil | TQGTPVHVYLPPDSLRVLAGASEVAPEPADEPLVAS |
Ga0209060_101056761 | 3300027826 | Surface Soil | DLAQGTPVHAYLPPDALRVLAGARGVVPEPEPLVTS |
Ga0209579_101784642 | 3300027869 | Surface Soil | GGSPDLAQGTPVHVYLPPDALRVLAGAAGEVPVAEDEPLVAT |
Ga0307280_103403291 | 3300028768 | Soil | MQNDGVRPDLTQGTPVHVFLPPDALRVLAGAQDVPIPEEEPLVAS |
Ga0302232_104716071 | 3300028789 | Palsa | GVSVQALMQNDGERPDLTQGTPVHAHLPAEALRVLAGAAGSVPVAADEPLVAS |
Ga0307304_102489042 | 3300028885 | Soil | TQGTPVHVYLPPDALRVLAGAQDVPVAEEEPLVAS |
Ga0311352_110559801 | 3300029944 | Palsa | RPDLTQGTPVHAHLPAEALRVLAGTSSPLPVPADEPLVAS |
Ga0302181_102491782 | 3300030056 | Palsa | LAQGTPVHAHLPAEALRVLAGSAAEVPVAADEPLVAR |
Ga0311372_105127773 | 3300030520 | Palsa | QGTPVHAHLPAEALRVLAGTSSPLPVPADEPLVAS |
Ga0311356_112258601 | 3300030617 | Palsa | WLAPGVLVQALVQNDGERPDLTQGTPVHAHLPTEALRVLAGTAGSVPVAADEPLVPS |
Ga0311354_119720581 | 3300030618 | Palsa | DLTQGTPVHAHLPAEALRVLAGTSSPLPVPADEPLVAS |
Ga0302325_100885561 | 3300031234 | Palsa | VSVQALMQNDGERPDLTQGTPVHAHLPAEALRVLAGAAGSVPVAADEPLVAS |
Ga0302325_114642581 | 3300031234 | Palsa | DLAQGTPVHAYLPPDALRVLAGARGVVPAPAEEPLVAT |
Ga0302324_1034019882 | 3300031236 | Palsa | DGDRPDLTQGTPVHAHLPAEALRVLAGAAGPLPVAADEPLVAS |
Ga0318571_101527582 | 3300031549 | Soil | DLAQGTPVHVYLPPDALRVLAGAAGEVPLAEDEQLVVS |
Ga0318571_102975251 | 3300031549 | Soil | GEHPDLAQGTPVHAYLPPDALRVLAGARDVAPALEEEPLVAS |
Ga0318571_104502101 | 3300031549 | Soil | MQNDGSRPDLAQGTPVNVYLPPDALRVLTGAAGEVPLAEDEHLVTT |
Ga0318542_102367011 | 3300031668 | Soil | DLAQGTPVNVYLPPDALRVLTGAAGEVPLAEDEHLVTT |
Ga0318561_101505611 | 3300031679 | Soil | QGSPIHAFLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0310686_1154185201 | 3300031708 | Soil | QNDGEHPDLAQGTPVHCYLPPHALRVLSGAAGEVPVPEDEPLVAS |
Ga0318496_108226861 | 3300031713 | Soil | GERPDLAQGSPVHAYLPPDALRVLAGASAEVPLAEDEPLVAS |
Ga0307474_105764082 | 3300031718 | Hardwood Forest Soil | RPDLVQGTPVHAYLPPDALRVLAGARGVVPAPAQEPLVAS |
Ga0318494_105813821 | 3300031751 | Soil | PELNQGSPIHAFLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0318521_103153171 | 3300031770 | Soil | DLAQGTPVHVYLPPDALRILAGAAGEVPLAEDEHLVVS |
Ga0318498_101765201 | 3300031778 | Soil | LLRLAPGNALQALMQNDGSRPDLTQGTPVNVYLPPNALRVLAGAAGEVRLAEDEHLVVS |
Ga0318498_103506852 | 3300031778 | Soil | HLDLAQGTPVHAYLPPDALRVLAGARNVAPAPEEEPLVAS |
Ga0318567_108572622 | 3300031821 | Soil | HPDLAQGTPVHAYLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0318511_102326801 | 3300031845 | Soil | AQGTPVNVYLPPDALRVLTGAAGEVPLAEDEHLVTT |
Ga0318511_105782421 | 3300031845 | Soil | DLAQGTPVHVYLPPDALRVLTGAAGEVPLAEDEHLVAS |
Ga0308175_1004943162 | 3300031938 | Soil | MQNDGSRADLAQGTPVNVYLPPDALRVLAGATGEVPLAEDEHLVAS |
Ga0318530_103690752 | 3300031959 | Soil | AQGTPVNVYLPPDALRVLAGSAGEVPIAEDEPLVAS |
Ga0318563_105183621 | 3300032009 | Soil | DLAQGTPVHAYLPPDALRVLAGARDVAPALEEEPLVAS |
Ga0318556_101232931 | 3300032043 | Soil | RPDLTQGTPVHVYLPPDALRVLAGAAGEVPLAEDEHLVVS |
Ga0318524_104951421 | 3300032067 | Soil | EHPDLAQGTPVHAYLPPDALRVLAGARGVVPAPVEEPLVAS |
Ga0318525_101812961 | 3300032089 | Soil | ELNQGTPIHAFLPPDALRVLAGARGVVPAPAEEPLVAS |
Ga0318525_102514681 | 3300032089 | Soil | PDHRVRPDLAQGTPVHVYLPPHALRVLAGAAGEVPLAEDEHLVAS |
Ga0311301_100501891 | 3300032160 | Peatlands Soil | HPDLAQGTPVHAYLPPDALRVLAGARGVVPAPAEEPLVTS |
Ga0306920_1028221521 | 3300032261 | Soil | DGEHPDLAQGTPVHAYLPPDALRVLAGARGVVPVPAEEPLVAS |
Ga0348332_101563881 | 3300032515 | Plant Litter | PELTQGTPVHCYLPPDALRVLAGSPGEVPVPADEPLVAS |
Ga0335078_125935532 | 3300032805 | Soil | SRPDLAQGTPVHAYLPPDALRVLAGAAGEVPLAEDEHLVAS |
Ga0335080_107583292 | 3300032828 | Soil | SRPDLAQGTPVHVYLPPDALRVLTGAAGEVPLAEDEHLVAS |
Ga0335069_104968363 | 3300032893 | Soil | QGTPVHVYLPPDALRVLTGAAGEVPLAEDEHLVAS |
Ga0335076_116484062 | 3300032955 | Soil | RPDLAQGTPVHVYLPPDALRVLTGAAGAVPLAEDEHLVAS |
Ga0310914_100895911 | 3300033289 | Soil | PDLTQGTPVNVYLPPNALRVLAGAAGEVRLAEDEHLVVS |
Ga0310914_102762893 | 3300033289 | Soil | LAQGTPVHVYLPPDALRVLAGATGEVPLAEDEHLVVS |
Ga0310914_103899381 | 3300033289 | Soil | DGEHPDLAQGTPVHAYLPPDALRVLAGARGAVPVPEEEPLVAS |
Ga0310914_109638262 | 3300033289 | Soil | VSLQALMQNDGTQLDLASGTPVHCYLPPDALRVLAGAHDVPIAADEPLVAT |
Ga0318519_105086922 | 3300033290 | Soil | NGGTQLDLASGTPVHCYLPPDALRVLAGAHDVPIAADEPLVAT |
⦗Top⦘ |