NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087790

Metagenome / Metatranscriptome Family F087790

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087790
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 43 residues
Representative Sequence MRALLVAGVAVVAVTAPAFAAALAPNEIQATFFNGQPFT
Number of Associated Samples 96
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 87.27 %
% of genes from short scaffolds (< 2000 bps) 77.27 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (63.636 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.727 % of family members)
Environment Ontology (ENVO) Unclassified
(37.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(35.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 46.27%    β-sheet: 0.00%    Coil/Unstructured: 53.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF028262-Hacid_dh_C 88.18
PF06347SH3_4 5.45
PF01475FUR 1.82
PF00551Formyl_trans_N 0.91
PF13808DDE_Tnp_1_assoc 0.91
PF07977FabA 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 1.82
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 0.91
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A63.64 %
All OrganismsrootAll Organisms36.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001139|JGI10220J13317_11662507Not Available571Open in IMG/M
3300001160|JGI12654J13325_1012609Not Available604Open in IMG/M
3300005332|Ga0066388_106994139Not Available568Open in IMG/M
3300005456|Ga0070678_101644717Not Available603Open in IMG/M
3300005547|Ga0070693_100074215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2011Open in IMG/M
3300005548|Ga0070665_100993379Not Available851Open in IMG/M
3300005549|Ga0070704_100717598All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300005578|Ga0068854_101266588Not Available663Open in IMG/M
3300005618|Ga0068864_100145683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2141Open in IMG/M
3300005713|Ga0066905_100178241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense1565Open in IMG/M
3300005764|Ga0066903_102582647Not Available984Open in IMG/M
3300006163|Ga0070715_10856054Not Available556Open in IMG/M
3300006177|Ga0075362_10285649Not Available817Open in IMG/M
3300006603|Ga0074064_11478267Not Available521Open in IMG/M
3300006605|Ga0074057_12191437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300006845|Ga0075421_102573594Not Available529Open in IMG/M
3300006904|Ga0075424_100221707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2009Open in IMG/M
3300006904|Ga0075424_102764975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300009093|Ga0105240_12757018Not Available506Open in IMG/M
3300009101|Ga0105247_10055003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14622456Open in IMG/M
3300009137|Ga0066709_101587845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales937Open in IMG/M
3300009553|Ga0105249_10129583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae2406Open in IMG/M
3300010043|Ga0126380_11024836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81697Open in IMG/M
3300010048|Ga0126373_13176473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense512Open in IMG/M
3300010396|Ga0134126_12089762Not Available619Open in IMG/M
3300010403|Ga0134123_11327101Not Available756Open in IMG/M
3300011269|Ga0137392_10617310Not Available899Open in IMG/M
3300011269|Ga0137392_10685586Not Available849Open in IMG/M
3300012189|Ga0137388_10423471Not Available1234Open in IMG/M
3300012203|Ga0137399_10222173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC372A001541Open in IMG/M
3300012357|Ga0137384_10670836All Organisms → cellular organisms → Bacteria → Proteobacteria843Open in IMG/M
3300012914|Ga0157297_10454298Not Available527Open in IMG/M
3300012924|Ga0137413_10010792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624469Open in IMG/M
3300012924|Ga0137413_11646284Not Available526Open in IMG/M
3300012977|Ga0134087_10231402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81839Open in IMG/M
3300013308|Ga0157375_12804395Not Available583Open in IMG/M
3300015374|Ga0132255_102522918Not Available785Open in IMG/M
3300015374|Ga0132255_103990102Not Available626Open in IMG/M
3300016371|Ga0182034_11871626Not Available529Open in IMG/M
3300016404|Ga0182037_11192233Not Available669Open in IMG/M
3300018061|Ga0184619_10008227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624017Open in IMG/M
3300018082|Ga0184639_10616948Not Available530Open in IMG/M
3300020579|Ga0210407_11329200Not Available536Open in IMG/M
3300021080|Ga0210382_10330747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81672Open in IMG/M
3300021178|Ga0210408_10172292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621718Open in IMG/M
3300021418|Ga0193695_1108763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales588Open in IMG/M
3300023072|Ga0247799_1029048All Organisms → cellular organisms → Bacteria → Proteobacteria869Open in IMG/M
3300025904|Ga0207647_10512933Not Available668Open in IMG/M
3300025905|Ga0207685_10091955Not Available1279Open in IMG/M
3300025929|Ga0207664_11576480Not Available579Open in IMG/M
3300025932|Ga0207690_11078524Not Available669Open in IMG/M
3300025939|Ga0207665_10079070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14622260Open in IMG/M
3300026035|Ga0207703_11337812All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300026515|Ga0257158_1125572Not Available517Open in IMG/M
3300027371|Ga0209418_1016844Not Available1200Open in IMG/M
3300027635|Ga0209625_1113334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales608Open in IMG/M
3300028716|Ga0307311_10249008Not Available528Open in IMG/M
3300028784|Ga0307282_10032942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense2248Open in IMG/M
3300028787|Ga0307323_10152510All Organisms → cellular organisms → Bacteria → Proteobacteria834Open in IMG/M
3300028875|Ga0307289_10034382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2003Open in IMG/M
3300028876|Ga0307286_10182351Not Available758Open in IMG/M
3300031199|Ga0307495_10046144All Organisms → cellular organisms → Bacteria → Proteobacteria873Open in IMG/M
3300031469|Ga0170819_11654112Not Available626Open in IMG/M
3300031544|Ga0318534_10426149Not Available761Open in IMG/M
3300031544|Ga0318534_10811300Not Available525Open in IMG/M
3300031561|Ga0318528_10418394Not Available719Open in IMG/M
3300031564|Ga0318573_10430453Not Available710Open in IMG/M
3300031573|Ga0310915_10536901All Organisms → cellular organisms → Bacteria → Proteobacteria830Open in IMG/M
3300031682|Ga0318560_10155902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 811209Open in IMG/M
3300031719|Ga0306917_10888228Not Available697Open in IMG/M
3300031723|Ga0318493_10409382All Organisms → cellular organisms → Bacteria → Proteobacteria742Open in IMG/M
3300031764|Ga0318535_10412372Not Available602Open in IMG/M
3300031764|Ga0318535_10537809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales518Open in IMG/M
3300031765|Ga0318554_10542885Not Available657Open in IMG/M
3300031771|Ga0318546_11066193Not Available568Open in IMG/M
3300031777|Ga0318543_10088769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense1317Open in IMG/M
3300031777|Ga0318543_10314479Not Available701Open in IMG/M
3300031780|Ga0318508_1005169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2707Open in IMG/M
3300031781|Ga0318547_10508547Not Available744Open in IMG/M
3300031797|Ga0318550_10466707Not Available610Open in IMG/M
3300031845|Ga0318511_10043635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621771Open in IMG/M
3300031846|Ga0318512_10619632Not Available552Open in IMG/M
3300031860|Ga0318495_10412620Not Available594Open in IMG/M
3300031897|Ga0318520_10125379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 811467Open in IMG/M
3300031897|Ga0318520_10473990All Organisms → cellular organisms → Bacteria → Proteobacteria771Open in IMG/M
3300031897|Ga0318520_10528952Not Available729Open in IMG/M
3300031944|Ga0310884_10941440Not Available534Open in IMG/M
3300031946|Ga0310910_10263779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 811349Open in IMG/M
3300031946|Ga0310910_10851334Not Available717Open in IMG/M
3300032013|Ga0310906_10832828Not Available654Open in IMG/M
3300032076|Ga0306924_11646690Not Available675Open in IMG/M
3300032076|Ga0306924_11817681Not Available634Open in IMG/M
3300032089|Ga0318525_10680647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales523Open in IMG/M
3300032091|Ga0318577_10015533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae3081Open in IMG/M
3300032261|Ga0306920_102318513Not Available743Open in IMG/M
3300033550|Ga0247829_11418711Not Available574Open in IMG/M
3300033551|Ga0247830_11404725Not Available558Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001160Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_078744702170459010Grass SoilMRASLAAVVTVLAVATPVVAATLTPNEIQAAFFTGQPFTASATNVK
JGI10220J13317_1166250723300001139SoilMRALFAAGMVVVASITPALAAVLAPNEIQATFFNGQ
JGI12654J13325_101260923300001160Forest SoilMRAVLLAGVTVIASIAPALAAVLAPADIQATFFNGQPFT
Ga0066388_10699413913300005332Tropical Forest SoilMRALIVAGAVVVAAIAPALAAVLAPAEIQSTFFNGQPFNSSAKGA
Ga0070678_10164471723300005456Miscanthus RhizosphereMRALLVGGVVVVASITPALAAALAPKDIQSTFFNGQPFTS
Ga0070693_10007421513300005547Corn, Switchgrass And Miscanthus RhizosphereMRALLVGGVVVVASITPALAAALAPKDIQSTFFNGQPFTSSTMSNVKFKMVF
Ga0070665_10099337923300005548Switchgrass RhizosphereMRALLVGGVVVVASITPALAAALAPKDIQSTFFNG
Ga0070704_10071759823300005549Corn, Switchgrass And Miscanthus RhizosphereMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPFTA
Ga0068854_10126658823300005578Corn RhizosphereMRALLVGGVVVIASITPALAAGLAPKDIQSTFFNGQPFTSSTMSNVKFKMVFTPDGKM
Ga0068864_10014568313300005618Switchgrass RhizosphereMRALFAAGMVVVASITPALAAVLAPNEIQATFFNGQPFTSSTPSNVKFKMVFT
Ga0066905_10017824133300005713Tropical Forest SoilMRALLVAGMALLTVATPVVAATLTPNEIQSTFFTGQPFTA
Ga0066903_10258264723300005764Tropical Forest SoilMRALFVAGVAVMASIAPAVAAVLAPAEIQATFFTGQPFTAS
Ga0070715_1085605423300006163Corn, Switchgrass And Miscanthus RhizosphereMRALFLAAVAVIAMTAPALAAALAPNEIQSTFFTGQAF
Ga0075362_1028564923300006177Populus EndosphereMRALLVGGVVVVASITPVLAAVLAPKDIQSTFFNGQPFTSSTMSNV
Ga0074064_1147826723300006603SoilMRALLVGGVVVIASITPALAAGLAPKDIQSTFFNGQPFTSST
Ga0074057_1219143713300006605SoilMRALLVAGAVVVASITPALAAVLAPNEIQATFFTGQPFTSSTPS
Ga0075421_10257359413300006845Populus RhizosphereMRALLVGGVIVVASIAPALAAVLAPKDIQSTFFNGQPFTSSTMSNV
Ga0075424_10022170733300006904Populus RhizosphereMRASLAAVVAILATATPVVAATLTPNEIQATFFTG
Ga0075424_10276497513300006904Populus RhizosphereMRALLVAGMAIVAAIAPALAAVLTPTEIQSTFFTGQ
Ga0105240_1275701813300009093Corn RhizosphereMRALLVGGVVVIASITPALAAALAPKDIQSTFFNGQPFTSSTMSNVKF
Ga0105247_1005500313300009101Switchgrass RhizosphereMRALFAAGMVVVASITPALAAVLAPNEIQATFFNGQPFTSSTP
Ga0066709_10158784513300009137Grasslands SoilMRASLVAVMAALAATTPVVAATLTPNEIQTTFFTGQP
Ga0105249_1012958313300009553Switchgrass RhizosphereMRALLVGGVVVVASITPALAAVLAPKDIQSTFFNGQP
Ga0126315_1092368223300010038Serpentine SoilMRALFVAAVAILALTTPAFAAALTPNEIQATFFNGQAFTASATNIK
Ga0126380_1102483613300010043Tropical Forest SoilMRTFLGVALAVIALTAPAWAATLEPNEIQSTFFTGQAFTS
Ga0126373_1317647313300010048Tropical Forest SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQAAFFTGQP
Ga0134126_1208976213300010396Terrestrial SoilMRALLVGGVVVVASITPAFAAGLAPKDIQSTFFNGQPFTSSTMS
Ga0134123_1132710113300010403Terrestrial SoilMRALFAAGMVVVASITPALAAVLAPNEIQATFFNGQPFTS
Ga0137392_1061731023300011269Vadose Zone SoilMRAFFVAGMAIVASIAPALAAVLTPSEIQSTFFTGQPFTSATPSN
Ga0137392_1068558623300011269Vadose Zone SoilMRALLLAGVVAIASIAPASAAVLAPNEIQATFFTGQPFTSSTPSNVKFKMVFA
Ga0137388_1042347113300012189Vadose Zone SoilMRALLLAGVVAIASIAPAFAAVLAPNEIQATFFTGQPFTSATPSNVKFKMV
Ga0137399_1022217313300012203Vadose Zone SoilMRALFVAGVAVFATIAPALAAVLAPNEIQATFFTGQAFTAS
Ga0137384_1067083623300012357Vadose Zone SoilMRASFVAAVAVLASIAPAFAAALTPNEIQATFFNG
Ga0157297_1045429813300012914SoilMRALFAAGMVVVASITPALAAVLAPNEIQATFFNGQPFTSSTPSNVKFKMVF
Ga0137413_1001079263300012924Vadose Zone SoilMRTSLMAGAVVIVATATALAATLTPNEIQSTFFTGQPFTAATPTNT
Ga0137413_1164628423300012924Vadose Zone SoilMRALFVAGVAVFATIAPALAAVLAPNEIQATFFTGQAFTASAT
Ga0126375_1005815933300012948Tropical Forest SoilMAAAAIVAITPPAFAAALTPNEIQTTFFTGQPFTASAPNIKYKM
Ga0134087_1023140223300012977Grasslands SoilMRASLVAVMAALAAITPVVAATLTPNEIQTTFFTGQPFTASATNVK
Ga0157375_1280439523300013308Miscanthus RhizosphereMRALLVGGVVVVASITPALAAGLAPKDIQSTFFNGQPFT
Ga0132255_10252291823300015374Arabidopsis RhizosphereMRALLVGGVVVVASITPAFSAGLAPKDIQSTFFNGQPFTSSTMSNVKFKMVFTPDGKM
Ga0132255_10399010223300015374Arabidopsis RhizosphereMRALFVAGVAAVAATTAALAAVLAPNEIQATFFTGQPFTAATPSNTKF
Ga0182034_1162681623300016371SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTASATNVKYRMTF
Ga0182034_1163835013300016371SoilMRALLIAGVVVVAVSAPAFAAALAPNEIQAAFFTGQPFTASATNVKYKMT
Ga0182034_1187162613300016371SoilMRALLLAGVAATVSIASAFAATLAPNDIQSTFFTGQPFTSATPSNIKFKMVFS
Ga0182037_1119223313300016404SoilMRALLVAGVAVVAVTAPAFAAALAPNEIQATFFNGQP
Ga0184619_1000822763300018061Groundwater SedimentMRALLVAGAVVVASITPALAAVLAPNEIQATFFTG
Ga0184639_1061694813300018082Groundwater SedimentMRALLVAGAVVVASITPALAAVLAPNEIQSTFFTGQPFT
Ga0210407_1132920013300020579SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQ
Ga0210382_1033074723300021080Groundwater SedimentMRSFLVAGVALVAAITSALAAALAPSDIQATFFTGQPFTASATNI
Ga0210408_1017229213300021178SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTG
Ga0193695_110876323300021418SoilMRALLVAGVVVVASITPALAAVLAPNEIQTTFFTGQPFTSSTPSNVKFKMV
Ga0247799_102904813300023072SoilMRALFAAGMVVVASITPALAAALAPKDIQSTFFNGQPFTSSTMSNVKFKM
Ga0207647_1051293323300025904Corn RhizosphereMRALFAAGMVVVASITPALAAVLAPNEIQATFFNGQPFTSSTPSN
Ga0207685_1009195523300025905Corn, Switchgrass And Miscanthus RhizosphereMRALLVGGVVVVASITPAFAAGLAPKDIQSTFFNGQPFTSSTMSNVKFKMVFTP
Ga0207664_1157648023300025929Agricultural SoilMRALFLAAVAVIAMTAPALAAALAPNEIQSTFFTGQAFTSS
Ga0207690_1107852413300025932Corn RhizosphereMRALLVGGVVVIASITPALAAGLAPKDIQSTFFNGQPFTSSTMSNVKFKMVFT
Ga0207665_1007907043300025939Corn, Switchgrass And Miscanthus RhizosphereMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPFTASA
Ga0207703_1133781213300026035Switchgrass RhizosphereMRAVCLAGLLVVVAAAPASAAVLAPNEIQATFFNGQPFTASTGSTKYKMVFS
Ga0209802_111398223300026328SoilMRAAFVAAVAIVAVTAPAFAAALTPNEIQATFFTGQPFTASAPNIKYKMI
Ga0257158_112557213300026515SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPFTAAA
Ga0209418_101684423300027371Forest SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPFTAAATNIWGS
Ga0209625_111333423300027635Forest SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPFT
Ga0307311_1024900813300028716SoilMRALLVAGVVVVASITPALAAVLAPNEIQTTFFTG
Ga0307282_1003294213300028784SoilMRALLVAGAVVVASITPALAAVLAPNEIQATFFTGQ
Ga0307323_1015251013300028787SoilMRALFVAGVAVMALIAPALAAVLAPNEIQATFFTGQPFT
Ga0307289_1003438233300028875SoilMRALLVAGVVVVASITPALAAVLAPNEIQTTFFTGQPFTSSTPSNVKFKMVFT
Ga0307286_1018235123300028876SoilMRALLVGGVVVIASITPALAAGLAPKDIQSTFFNGQPFTSSTMSNVKFKMVF
Ga0307495_1004614423300031199SoilMRALLVAGAVVVASITPALAAVLAPNEIQSTFFTGQPFTSSTPSN
Ga0170819_1165411213300031469Forest SoilMRALLVAGVVVVASITPALAAVLAPKDIQSTFFNGQPFTSSTMSNVKFK
Ga0318534_1042614913300031544SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQPF
Ga0318534_1081130023300031544SoilMRALLVAGVAVVAVTAPAFAAALAPNEIQATFFNGQPFT
Ga0318528_1041839413300031561SoilMRALLIAGVVVVAVSAPAFAAALAPNEIQAAFFTG
Ga0318573_1043045323300031564SoilMRTWLLAGVVAISAVAPAAAAMLAPNEIQATFFNGQPFTASSG
Ga0310915_1053690123300031573SoilMRTWLLAGVVAISAVAPAAAAMLAPNEIQATFFNGQPFTASSGSTK
Ga0318574_1053247123300031680SoilMRALLVAGVAVVAVTASAFAAALAPNEIQATFFNGQPFTASATNVKYK
Ga0318560_1015590213300031682SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQAAFFTGQPFTASA
Ga0306917_1088822813300031719SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTAAA
Ga0318493_1040938213300031723SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQAAFFTG
Ga0318535_1041237213300031764SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQPFTAS
Ga0318535_1053780923300031764SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQAAFFTGQPFTA
Ga0318554_1054288523300031765SoilMRTWLLAGVVAISAVAPAAAAMLAPNEIQATFFNGQP
Ga0318546_1106619313300031771SoilMRALLLAGVIACAAIAPASAATLSPTEIQSTFFTGQPFTSATPSNVKFKMVFM
Ga0318543_1008876913300031777SoilMRPSLVVAAAVVAVTAPAFAATLTPNEIQSTFFNGQP
Ga0318543_1031447913300031777SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTAAATNVKY
Ga0318508_100516943300031780SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQPFTA
Ga0318547_1050854713300031781SoilMRALLLAGVIACAAIAPASAATLSPTEIQSTFFTGQPF
Ga0318550_1046670723300031797SoilMRPSLVVAAAVVAVTAPAFAATLTPNEIQSTFFNGQPFTAAAT
Ga0318550_1051382323300031797SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPFTASATNVKYKMT
Ga0318511_1004363533300031845SoilMRALLVAGVAVVAVTASAFAAALAPNEIQATFFNGQPFTASATN
Ga0318512_1061963213300031846SoilMRALLVAGVAVVAVTASAFAAALAPNEIQATFFNGQPF
Ga0318527_1002654643300031859SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQPFTASTGNTKYKMT
Ga0318495_1041262013300031860SoilMRTWLLAGVVAISAVAPAAAAMLAPNEIQATFFNGQPFT
Ga0318544_1020806523300031880SoilMRALLVAGVAVVAVTAPAFAAALAPNEIQATFFNGQPFTASATNVKYKMT
Ga0318520_1012537923300031897SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQ
Ga0318520_1047399013300031897SoilMRALLLAGVAATVSIASAFAATLAPNDIQSTFFTGQPFT
Ga0318520_1052895213300031897SoilMRALLIAGVAVVAVTAPAFAAALAPNEIQATFFTGQPF
Ga0310884_1094144023300031944SoilMRALLVGGVVVIASITPALAAGLAPKDIQSTFFNGQPFTSSTMSNVKFKMV
Ga0310910_1026377923300031946SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQPFT
Ga0310910_1085133413300031946SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTAAAT
Ga0318563_1081176923300032009SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTAAATNVKYKMT
Ga0310906_1083282823300032013SoilMRALFAAGMVVVAVITPALAAVLAPNEIQATFFNGQPFTSST
Ga0318506_1017738313300032052SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTASATNVKYKMTF
Ga0318513_1058928813300032065SoilMRALLVAGVAVVAVTASAFAAALAPNEIQATFFNGQPFTASATNVKY
Ga0306924_1164669013300032076SoilMRAVLLTGVSLIASIAPAFAAVLAPADIQATFFNGQPF
Ga0306924_1181768123300032076SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQPFTASTGNTKYK
Ga0318525_1068064713300032089SoilMRALLIAGVAVVAVSAPAFAAALAPNEIQATFFTGQPFTASATN
Ga0318577_1001553353300032091SoilMRTLLLAGAVAIVAVAPVFAATLAPSEIQATFFTGQP
Ga0306920_10231851313300032261SoilMRALIIAGAVVVAAVAPALAAVLAPAEIQSTFFNGQPFNSSA
Ga0247829_1141871113300033550SoilMRTLLLAGPAVLASIALAVAAVLAPKDIQATFFTGQAFT
Ga0247830_1140472523300033551SoilMRTLLLAGAAVLASIALAVAAVLAPKDIQATFFTGQAFTAATPSNVKFK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.