| Basic Information | |
|---|---|
| Family ID | F087786 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GAIIGVIMSITMPWEGWSDPQAFVDMFERIDQALNLLEAGLPL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 91.82 % |
| % of genes from short scaffolds (< 2000 bps) | 96.36 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF10011 | DUF2254 | 14.55 |
| PF12831 | FAD_oxidored | 10.91 |
| PF00652 | Ricin_B_lectin | 6.36 |
| PF03358 | FMN_red | 6.36 |
| PF00440 | TetR_N | 2.73 |
| PF13302 | Acetyltransf_3 | 1.82 |
| PF00296 | Bac_luciferase | 1.82 |
| PF00920 | ILVD_EDD | 1.82 |
| PF02653 | BPD_transp_2 | 0.91 |
| PF01545 | Cation_efflux | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF13751 | DDE_Tnp_1_6 | 0.91 |
| PF04978 | DUF664 | 0.91 |
| PF01989 | AcnX_swivel_put | 0.91 |
| PF05598 | DUF772 | 0.91 |
| PF03795 | YCII | 0.91 |
| PF02627 | CMD | 0.91 |
| PF00072 | Response_reg | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 3.64 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.82 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.91 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1786 | Mevalonate 5-phosphate dehydratase subunit 2, swiveling domain (modified mevalonate pathway) | Lipid transport and metabolism [I] | 0.91 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.91 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig05961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1309 | Open in IMG/M |
| 2170459021|G14TP7Y02FYKLA | Not Available | 561 | Open in IMG/M |
| 3300003368|JGI26340J50214_10141185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300004092|Ga0062389_102133547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300004152|Ga0062386_101206810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300005334|Ga0068869_101082901 | Not Available | 701 | Open in IMG/M |
| 3300005434|Ga0070709_10656067 | Not Available | 813 | Open in IMG/M |
| 3300005434|Ga0070709_11304935 | Not Available | 585 | Open in IMG/M |
| 3300005434|Ga0070709_11732401 | Not Available | 510 | Open in IMG/M |
| 3300005435|Ga0070714_101425110 | Not Available | 676 | Open in IMG/M |
| 3300005437|Ga0070710_10737072 | Not Available | 698 | Open in IMG/M |
| 3300005456|Ga0070678_100185319 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300005537|Ga0070730_10555874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 734 | Open in IMG/M |
| 3300005540|Ga0066697_10673775 | Not Available | 568 | Open in IMG/M |
| 3300005764|Ga0066903_104851500 | Not Available | 715 | Open in IMG/M |
| 3300005843|Ga0068860_101958765 | Not Available | 607 | Open in IMG/M |
| 3300006028|Ga0070717_10896007 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300006028|Ga0070717_11603703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300006163|Ga0070715_10928153 | Not Available | 538 | Open in IMG/M |
| 3300006176|Ga0070765_100074445 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300006755|Ga0079222_10456346 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300006804|Ga0079221_11089449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300006854|Ga0075425_100959284 | Not Available | 976 | Open in IMG/M |
| 3300006893|Ga0073928_10742660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Sulfobacillus → Sulfobacillus thermosulfidooxidans | 682 | Open in IMG/M |
| 3300006893|Ga0073928_11198700 | Not Available | 511 | Open in IMG/M |
| 3300009012|Ga0066710_104847536 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009137|Ga0066709_100671502 | Not Available | 1486 | Open in IMG/M |
| 3300009162|Ga0075423_11030523 | Not Available | 875 | Open in IMG/M |
| 3300009176|Ga0105242_10231687 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300009525|Ga0116220_10196303 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009698|Ga0116216_10480981 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300010371|Ga0134125_12346065 | Not Available | 580 | Open in IMG/M |
| 3300010379|Ga0136449_100685336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1723 | Open in IMG/M |
| 3300010858|Ga0126345_1161696 | Not Available | 694 | Open in IMG/M |
| 3300010864|Ga0126357_1123881 | Not Available | 630 | Open in IMG/M |
| 3300010880|Ga0126350_11835478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300012203|Ga0137399_11586259 | Not Available | 542 | Open in IMG/M |
| 3300012929|Ga0137404_11195649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300012929|Ga0137404_11636869 | Not Available | 597 | Open in IMG/M |
| 3300012986|Ga0164304_11116946 | Not Available | 632 | Open in IMG/M |
| 3300013105|Ga0157369_12167467 | Not Available | 563 | Open in IMG/M |
| 3300013306|Ga0163162_10226589 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300013306|Ga0163162_11617720 | Not Available | 739 | Open in IMG/M |
| 3300015264|Ga0137403_11182640 | Not Available | 610 | Open in IMG/M |
| 3300015374|Ga0132255_104344524 | Not Available | 601 | Open in IMG/M |
| 3300016319|Ga0182033_10839257 | Not Available | 811 | Open in IMG/M |
| 3300016404|Ga0182037_10906132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300017823|Ga0187818_10304107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300017926|Ga0187807_1029169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1708 | Open in IMG/M |
| 3300017995|Ga0187816_10050772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1732 | Open in IMG/M |
| 3300018034|Ga0187863_10434305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300018047|Ga0187859_10765620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia seriolae | 552 | Open in IMG/M |
| 3300018085|Ga0187772_10600226 | Not Available | 783 | Open in IMG/M |
| 3300020580|Ga0210403_10308300 | Not Available | 1297 | Open in IMG/M |
| 3300020580|Ga0210403_10628758 | Not Available | 865 | Open in IMG/M |
| 3300021180|Ga0210396_10246667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1588 | Open in IMG/M |
| 3300021180|Ga0210396_11598100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300021401|Ga0210393_11173566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 619 | Open in IMG/M |
| 3300021405|Ga0210387_10271441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
| 3300024249|Ga0247676_1006747 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300024317|Ga0247660_1016548 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300025134|Ga0207416_1197602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300025898|Ga0207692_10129291 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300025904|Ga0207647_10301341 | Not Available | 913 | Open in IMG/M |
| 3300025915|Ga0207693_10331531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1191 | Open in IMG/M |
| 3300025915|Ga0207693_10859024 | Not Available | 697 | Open in IMG/M |
| 3300025921|Ga0207652_10147048 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300025942|Ga0207689_11417691 | Not Available | 582 | Open in IMG/M |
| 3300026309|Ga0209055_1044629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1941 | Open in IMG/M |
| 3300027047|Ga0208730_1009842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1015 | Open in IMG/M |
| 3300027063|Ga0207762_1037931 | Not Available | 721 | Open in IMG/M |
| 3300027812|Ga0209656_10042152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis taiwanensis | 2633 | Open in IMG/M |
| 3300027882|Ga0209590_10097727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1748 | Open in IMG/M |
| 3300027889|Ga0209380_10652501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300028863|Ga0302218_10154045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300029944|Ga0311352_10987572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300030056|Ga0302181_10399088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d | 593 | Open in IMG/M |
| 3300030057|Ga0302176_10374954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300030399|Ga0311353_10533746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
| 3300030524|Ga0311357_11818256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia seriolae | 506 | Open in IMG/M |
| 3300030739|Ga0302311_10401223 | Not Available | 965 | Open in IMG/M |
| 3300030743|Ga0265461_10246763 | Not Available | 1172 | Open in IMG/M |
| 3300031525|Ga0302326_10912401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
| 3300031549|Ga0318571_10453688 | Not Available | 509 | Open in IMG/M |
| 3300031564|Ga0318573_10415258 | Not Available | 723 | Open in IMG/M |
| 3300031680|Ga0318574_10024796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2971 | Open in IMG/M |
| 3300031713|Ga0318496_10549259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300031723|Ga0318493_10811943 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031747|Ga0318502_10739347 | Not Available | 595 | Open in IMG/M |
| 3300031753|Ga0307477_10194936 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300031754|Ga0307475_10572453 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031764|Ga0318535_10501796 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031765|Ga0318554_10072125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1915 | Open in IMG/M |
| 3300031805|Ga0318497_10455411 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031805|Ga0318497_10544914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300031821|Ga0318567_10400454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300031831|Ga0318564_10136710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
| 3300031833|Ga0310917_10996980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 562 | Open in IMG/M |
| 3300031896|Ga0318551_10190952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1130 | Open in IMG/M |
| 3300031939|Ga0308174_11819005 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031942|Ga0310916_11072127 | Not Available | 670 | Open in IMG/M |
| 3300031954|Ga0306926_11739279 | Not Available | 710 | Open in IMG/M |
| 3300031954|Ga0306926_12889919 | Not Available | 516 | Open in IMG/M |
| 3300032009|Ga0318563_10280363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300032009|Ga0318563_10515190 | Not Available | 646 | Open in IMG/M |
| 3300032066|Ga0318514_10700098 | Not Available | 539 | Open in IMG/M |
| 3300032770|Ga0335085_10808159 | Not Available | 1031 | Open in IMG/M |
| 3300032770|Ga0335085_12069161 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300033134|Ga0335073_11407779 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300033290|Ga0318519_10156596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.09% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.73% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00620570 | 2166559006 | Grass Soil | MSITMPWEGWSSDRQAIVDMFERIDQALNLLEAGLPL |
| 4NP_04066530 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | VAGAIIGVIMSITMPWEGWSSDQQIVDMFARIDQALALLEAGLPL |
| JGI26340J50214_101411852 | 3300003368 | Bog Forest Soil | MGDAVVGVIMSVTMPWEGWTERTSVEDTFGRIDEALGLLEAGLPL* |
| Ga0062389_1021335472 | 3300004092 | Bog Forest Soil | AGAIIGVIMSITMPWDGWSDRQTIADTFARIDQALALLEVGLPL* |
| Ga0062386_1012068102 | 3300004152 | Bog Forest Soil | IGVIMSITMPWDGWSDRQTMQSTFQRIDQALGLLEAGLPL* |
| Ga0068869_1010829012 | 3300005334 | Miscanthus Rhizosphere | DDLAVRTLAGAIIGVIMSITMPWEGWSDGQAFVDMFERVDQALNLLEAGLPL* |
| Ga0070709_106560672 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVIMSITMPWEGWSDPQAFVYMFERVDQALNLLEAGLPL* |
| Ga0070709_113049352 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ADDLAVRTLAGAIIGVIMSITMPWEGWSDPQGFVDMFERVDQALNLLEAGLPL* |
| Ga0070709_117324012 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0070714_1014251102 | 3300005435 | Agricultural Soil | GAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0070710_107370722 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFADTFERIDQALNLLEAGLPL* |
| Ga0070678_1001853193 | 3300005456 | Miscanthus Rhizosphere | PADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0070730_105558741 | 3300005537 | Surface Soil | VIMSITMPWEGWSEGRSFEDMFGRIDEALAFLEAGLPL* |
| Ga0066697_106737751 | 3300005540 | Soil | ITMPWQGWSDPQAFEDMFERVDQALNLLEAGLPL* |
| Ga0066903_1048515001 | 3300005764 | Tropical Forest Soil | AGAIIGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL* |
| Ga0068860_1019587651 | 3300005843 | Switchgrass Rhizosphere | RPADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0070717_108960073 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSITMPWHGWSSDMQTIEDVFGRIDQALALLEAGLPL* |
| Ga0070717_116037032 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IIGVIMSVTMPWEGWSDGQSFEDMFGRIDQALALLEAGLPL* |
| Ga0070715_109281531 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLAGAIIGVIMSITMPWEGWSDGQAFVDTFERIDQALNLLEAGLPL* |
| Ga0070765_1000744451 | 3300006176 | Soil | GAIIGVIMSITLPWDGWSDPQNIKETFARIDTALGLLEAGLPL* |
| Ga0079222_104563463 | 3300006755 | Agricultural Soil | AGAIIGVIMSITMPWEGWTDPQAFMDTFERIDQALNLLEAGLPL* |
| Ga0079221_110894491 | 3300006804 | Agricultural Soil | AMAGGFIGVILSVTLPVEGWPGDDQSIIAMFERIDQALALLEAGLPL* |
| Ga0075425_1009592843 | 3300006854 | Populus Rhizosphere | LAVRTLAGAIIGVIMSITMPWEGWSDRQAIVDMFERIDQALNLLEAGLPL* |
| Ga0073928_107426602 | 3300006893 | Iron-Sulfur Acid Spring | VAGAIIGVIMSITIPWENWSDGTSFEDTFARIDEALALLEAGLPL* |
| Ga0073928_111987001 | 3300006893 | Iron-Sulfur Acid Spring | MSITIPWENWSDGTSFEDTFARIDEALALLEAGLPL* |
| Ga0066710_1048475361 | 3300009012 | Grasslands Soil | IGVMMSLTMPWHGWASDMQTIEDLLGRIDQALALLEAGLPL |
| Ga0066709_1006715021 | 3300009137 | Grasslands Soil | MCITMPWEGGSDPKAFVYMFEGVDQGLNLLEAGLPL* |
| Ga0075423_110305231 | 3300009162 | Populus Rhizosphere | VIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0105242_102316873 | 3300009176 | Miscanthus Rhizosphere | IIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0116220_101963032 | 3300009525 | Peatlands Soil | MSITMPWEDWSSDRRTIEDMFERIDQALALLEAGLPL* |
| Ga0116216_104809812 | 3300009698 | Peatlands Soil | VIMAITMPWEDWSERPSAFEDSFGRIDEALALLEAGLPL* |
| Ga0134125_123460652 | 3300010371 | Terrestrial Soil | AVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0136449_1006853361 | 3300010379 | Peatlands Soil | RTVAGAIIGVIMAITLPWEGWSEQVSLEDTFARIDKALALLEAGLPL* |
| Ga0126345_11616961 | 3300010858 | Boreal Forest Soil | GVIMSVTMPWEGWSDGKSFEDMFRRIDQALALLEAGLPL* |
| Ga0126357_11238812 | 3300010864 | Boreal Forest Soil | VGVVMSVTMPWEGWSQAPNFEDMFVRIDEALALLEAGLPL* |
| Ga0126350_118354782 | 3300010880 | Boreal Forest Soil | SITLPWSGWADRRSMQDTFGRIDRALALLEAGLPL* |
| Ga0137399_115862591 | 3300012203 | Vadose Zone Soil | VIMSITMPWEGWSDPEAFVDMFERVDQALNLLEAGLPL* |
| Ga0137404_111956491 | 3300012929 | Vadose Zone Soil | IGVMMALTMPWDGWTTDRQAIADLFGRVDQALALLEAGLPL* |
| Ga0137404_116368691 | 3300012929 | Vadose Zone Soil | VRTLAGAIIGVIMSITMPWEGWSDPAAFVDMFERVDQALNLLEAGLPL* |
| Ga0164304_111169462 | 3300012986 | Soil | DDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0157369_121674672 | 3300013105 | Corn Rhizosphere | GAIIGVIMSITMPWEGWSDPQGFVDMFERVDQALNLLEAGLPL* |
| Ga0163162_102265891 | 3300013306 | Switchgrass Rhizosphere | IMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL* |
| Ga0163162_116177202 | 3300013306 | Switchgrass Rhizosphere | VRTLAGAIIGVIMSITMPWEGWSDGQAFVDMFERVDQALNLLEAGLPL* |
| Ga0137403_111826401 | 3300015264 | Vadose Zone Soil | ADDLAVRTLAGAIIGVIMSITMPWEGWSDPAAFVDMFERVDQALNLLEAGLPL* |
| Ga0132255_1043445242 | 3300015374 | Arabidopsis Rhizosphere | GAIIGVIMSITMPWEGWSDPQAFVDMFERIDQALNLLEAGLPL* |
| Ga0182033_108392572 | 3300016319 | Soil | VRVMAGAIIGVIMSTTIPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL |
| Ga0182037_109061323 | 3300016404 | Soil | GVMMSLTMPWEGWSSDWQTFEDLFQHVDQALALLEAGLPL |
| Ga0187818_103041071 | 3300017823 | Freshwater Sediment | AIIGVIMSITMPWDGWSDRQTIGDTFERIDAALALLEAGLPL |
| Ga0187807_10291694 | 3300017926 | Freshwater Sediment | AVRTAAGAIIGVIMAITMPWEGWSEGGVFEDSFRQIDEALALLEAGLPL |
| Ga0187816_100507721 | 3300017995 | Freshwater Sediment | RPADDLAVRTAAGAIIGVIMAITLPWEGWSEGTAFEDAFGGIDEALALLEAGLPL |
| Ga0187863_104343051 | 3300018034 | Peatland | GAIVGVIMSITLPWDGWSDPQTMGVTFARIDTALGLLEAGLPL |
| Ga0187859_107656201 | 3300018047 | Peatland | GRPADDLAVRTITGAIIGVIMSITLPWEGWSDRQNVEDMFVRIDRALTLLEAGLPL |
| Ga0187772_106002261 | 3300018085 | Tropical Peatland | MAITIPWEGWSDGVRFEDTFGRIDEALALLEAGLPL |
| Ga0210403_103083004 | 3300020580 | Soil | GVIMSIAMPWEGWSSDRQAIVDMFERIDQALNLLEAGLPL |
| Ga0210403_106287581 | 3300020580 | Soil | DLAVRTVAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL |
| Ga0210396_102466674 | 3300021180 | Soil | GAVVGVIMSITIPWEGWSDRTSFEDTFARIDQALALLEAGLPL |
| Ga0210396_115981002 | 3300021180 | Soil | IMSITIPWEGWSDRTSFEDTFVRIDQALALLEAGLPL |
| Ga0210393_111735662 | 3300021401 | Soil | VIMAITLPWEGWSDQTSFEDTFNRIDEALALLEAGLPL |
| Ga0210387_102714411 | 3300021405 | Soil | VIMSITIPWEGWSDRTSFEDTFARIDQALALLEAGLPL |
| Ga0247676_10067471 | 3300024249 | Soil | MSITMPWEGWSDPQAFVDLFERVDQALNLLEAGLPL |
| Ga0247660_10165481 | 3300024317 | Soil | IGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL |
| Ga0207416_11976021 | 3300025134 | Iron-Sulfur Acid Spring | VRTVAGAIIGVVMSITIPWENWSDGTSFEDTFARIDEALALLEAGLPL |
| Ga0207692_101292911 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVRTLAGAVIGVIMSITMPWEGWSDPQAFVYMFERVDQALNLLEAGLPL |
| Ga0207647_103013412 | 3300025904 | Corn Rhizosphere | DDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL |
| Ga0207693_103315311 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PADDLAVRTLAGAIIGVIMSITMPWEGWSDPQGFVDMFERVDQALNLLEAGLPL |
| Ga0207693_108590243 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL |
| Ga0207652_101470481 | 3300025921 | Corn Rhizosphere | IMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL |
| Ga0207689_114176911 | 3300025942 | Miscanthus Rhizosphere | LAGAIIGVIMSITMPWEGWSDGQAFVDMFERVDQALNLLEAGLPL |
| Ga0209055_10446292 | 3300026309 | Soil | MSITMPWEGWSDPQAFVYMFERVDQALNLLEAGLPL |
| Ga0208730_10098421 | 3300027047 | Forest Soil | QYTVIAIIGVIMAITIPWEGWSDRARFEDTFTRIDQALALLEAGLPL |
| Ga0207762_10379311 | 3300027063 | Tropical Forest Soil | RPPEDLAVRVMAGAIIGVIMSLTIPWEGWSDRQTLEDTFGRIEQGLALLEAGLPL |
| Ga0209656_100421524 | 3300027812 | Bog Forest Soil | MGDAVVGVIMSVTMPWEGWTERTSVEDTFGRIDEALGLLEAGLPL |
| Ga0209590_100977275 | 3300027882 | Vadose Zone Soil | MSITMPWEGWSSDRQTIEDTFQRIDQALALLEAGLPL |
| Ga0209380_106525012 | 3300027889 | Soil | AIIGVIMAITLPWEGWSDQTSFEDTFNRIDEALALLEAGLPL |
| Ga0302218_101540451 | 3300028863 | Palsa | VGVIMSITLPWDGWSDPQNMAETFGRIDTALGLLEAGLPL |
| Ga0311352_109875722 | 3300029944 | Palsa | LTVRTIAGAIIGVVMSITLPWDGWSDRQTIEETFGRIDTALGLLEAGLPL |
| Ga0302181_103990881 | 3300030056 | Palsa | RTTAGAIIGVIISITMPWEGEGWSDAKNIEETFRTIDQALAVLEAGLPI |
| Ga0302176_103749541 | 3300030057 | Palsa | IMSITLPWDGWSDPQNMAETFGRIDAALGLLEAGLPL |
| Ga0311353_105337461 | 3300030399 | Palsa | AIIGVIMSITLPWDGWSDPQNIKETFGRIDTALGLLEAGLPL |
| Ga0311357_118182561 | 3300030524 | Palsa | TVRTIAGAIIGVIMSITMPWDGWSDRQNIEDTFGRIDTALGVLEAGLPL |
| Ga0302311_104012231 | 3300030739 | Palsa | VMSITMPWDGWSEGHGFEDAFGRIDEALALLEAGLPL |
| Ga0265461_102467632 | 3300030743 | Soil | AGAVIGVIMAITIPWEGWSDRTRFEDTFARIDQALALLEAGLPL |
| Ga0302326_109124011 | 3300031525 | Palsa | VIMSITLPWDGWSDPQNMAETFGRIDAALGLLEAGLPL |
| Ga0318571_104536881 | 3300031549 | Soil | SITMPWEGWSSDRQTIVDMFERIDQALSLLEDGLPL |
| Ga0318573_104152582 | 3300031564 | Soil | VGAIMSITMPWEGWSDQQTLEGTFQRIEQGLALLEAGLPL |
| Ga0318574_100247961 | 3300031680 | Soil | MAGAIIGVIMSTTIPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL |
| Ga0318496_105492591 | 3300031713 | Soil | VIMSVTMPWEGWSEGTSFEDTFGRIDEALGLLEAGLPL |
| Ga0318493_108119432 | 3300031723 | Soil | IMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL |
| Ga0318502_107393471 | 3300031747 | Soil | IGVIMSVTMPWEGWSEGHAFEHSFERIDEALGLLEAGLPL |
| Ga0307477_101949362 | 3300031753 | Hardwood Forest Soil | MSITIPWEGWSDRTRFEDTFVRIDQALALLEAGLPL |
| Ga0307475_105724532 | 3300031754 | Hardwood Forest Soil | MSITIPWEGWSDRTRFEDTFVRIDQALALLEACLPL |
| Ga0318535_105017962 | 3300031764 | Soil | SITMPWAGWSSDRQIIMDMFERIDQALALLEAGLPL |
| Ga0318554_100721251 | 3300031765 | Soil | SITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL |
| Ga0318497_104554112 | 3300031805 | Soil | GVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL |
| Ga0318497_105449142 | 3300031805 | Soil | SITMPWEGWSDQQTLEGTFQRIEQGLALLEAGLPL |
| Ga0318567_104004543 | 3300031821 | Soil | VIMSVTLPWSDWTSESATDDMFARIDEALALLESGLPL |
| Ga0318564_101367103 | 3300031831 | Soil | LVVRVMAGAIIGVIMSTTMPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL |
| Ga0310917_109969802 | 3300031833 | Soil | AIIGVIMSVTMPWEGWSEGHAFEHSFERIDEALGLLEAGLPL |
| Ga0318551_101909521 | 3300031896 | Soil | GVIMSVTMPWEGWSEGTSFEETFGRIDEALGLLEAGLPL |
| Ga0308174_118190051 | 3300031939 | Soil | GVMMSITMPWHGWSSDMQTIEDVFGRIDQALALLEAGLPL |
| Ga0310916_110721272 | 3300031942 | Soil | IMSTTIPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL |
| Ga0306926_117392791 | 3300031954 | Soil | SLTMPWEGWSSHLQTFEDVFQQIDQALALLEAGLPL |
| Ga0306926_128899191 | 3300031954 | Soil | GAIIGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL |
| Ga0318563_102803631 | 3300032009 | Soil | IMSITMPWEGWSSDRQTVEDMFERIDQALALLEAGLPL |
| Ga0318563_105151902 | 3300032009 | Soil | IGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL |
| Ga0318514_107000982 | 3300032066 | Soil | GVIMSITMPWEGWSSDRQIVDMFARIDEALALLEAGLPL |
| Ga0335085_108081592 | 3300032770 | Soil | VRTVAGAIIGVIMSITMPWEGWSSDRQVIVDMFERIDQALGLLEDGLPL |
| Ga0335085_120691612 | 3300032770 | Soil | MSITMPWEGWSSDRRTLEDMFGRIEQALALLEAGLPL |
| Ga0335073_114077791 | 3300033134 | Soil | ITMPWEGWSSDRQAIVDMFERIDQALNLLEAGLPL |
| Ga0318519_101565963 | 3300033290 | Soil | ADDLAVRTVAGAIIGVIMSITMPWEGWSSDRQTIVDMFERIDQALSLLEDGLPL |
| ⦗Top⦘ |