| Basic Information | |
|---|---|
| Family ID | F087755 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | IRITSGKFGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (86.364 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (39.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 11.76% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13730 | HTH_36 | 52.73 |
| PF14090 | HTH_39 | 5.45 |
| PF05766 | NinG | 2.73 |
| PF11753 | DUF3310 | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 86.36 % |
| All Organisms | root | All Organisms | 13.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 39.09% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.36% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 10.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.36% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.64% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 3.64% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.64% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.73% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.73% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 2.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.82% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
| 3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102570252 | 3300000101 | Marine | GTDVKVSYRDFYNQLENVKLALQNFKYEIEIITL* |
| JGI24006J15134_100431615 | 3300001450 | Marine | QTIIRITSGKVEADIKVSYKDFYNQLELCKLALQDCKYNLEII* |
| JGI24003J15210_101632471 | 3300001460 | Marine | VGTDIKLSYRDFYNQLENVKIALQNYKYETEIITL* |
| JGI24004J15324_1000492414 | 3300001472 | Marine | IRIVSGKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| JGI24004J15324_100897501 | 3300001472 | Marine | VKTGKLETNVKVSYRDFYNQLENIKLALQDYKYTIKVT* |
| Ga0070728_105150601 | 3300005588 | Marine Sediment | SGKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0070723_106336372 | 3300005612 | Marine Sediment | RIISGKFGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0075441_101840281 | 3300006164 | Marine | TIRIQSGKVGTDVKVSYRNFYNQLENVKLALQNFKYEIEIITL* |
| Ga0098048_10780741 | 3300006752 | Marine | QTTIRIIAGKFGTDIKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0098044_12524782 | 3300006754 | Marine | IHDSSKHQTTIRIVSGKFGKDVKVSYKDFYSQLELCKLALQNYQHEIEVI* |
| Ga0098044_13071531 | 3300006754 | Marine | TLRISSGKVEADVKVSYKDFYDQLEKCKFAMTDCKYNLEII* |
| Ga0098044_13990772 | 3300006754 | Marine | HQTTIRISTGKLKIAGNVSYKDVYNQLELCKLALQNYQHEIEVI* |
| Ga0098055_13411332 | 3300006793 | Marine | IIDSLNHQTTIRVTTGRFTVAVNVSYKDFYNQLENVKLALQDYQFEIEIV* |
| Ga0098060_11674552 | 3300006921 | Marine | SGRIEYDVKVSYRDFYDQLEKCKFALTDCNYNLEII* |
| Ga0098051_10733133 | 3300006924 | Marine | SGNVGVDIKVSYKDFYNQLELCKLALRDCNYNLEIL* |
| Ga0098034_10118061 | 3300006927 | Marine | STGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0098034_10798761 | 3300006927 | Marine | TTIRISTGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0098034_12276502 | 3300006927 | Marine | RISTGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0098041_11186131 | 3300006928 | Marine | LSGKFGTDIKVSYRDFYNQLELCKLALQNYQHEIEVI* |
| Ga0070753_12563851 | 3300007346 | Aqueous | IFDSDKHQTTIRISCGKFGTDVKVSYREFYNKFELCKLALENYKYEIEVI* |
| Ga0098052_10881511 | 3300008050 | Marine | NSSNHQTTIRITSGKFGTDIKVSYREFYNQLEICKLALQNYIHEIEVI* |
| Ga0098052_11909071 | 3300008050 | Marine | TIRISTGKLGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0114910_12155432 | 3300008220 | Deep Ocean | IVSGKFGKDVKVSYKDFYNQLKLCKLALQNYQHEIEVI* |
| Ga0114916_11298911 | 3300008221 | Deep Ocean | SEKEQVIIRIKSGKVGTDIKVSYRNFYNQLENVKIALQNFKYDIEIITL* |
| Ga0115371_104017801 | 3300008470 | Sediment | SGKVGTDVKVSYRNFYNQLENVKLALQNFKYEIEIINL* |
| Ga0115371_107342913 | 3300008470 | Sediment | QVIIRIKSGKVGTDVKVSYRNFYNQLENVKLALQNFKYEIEIITL* |
| Ga0115371_110919812 | 3300008470 | Sediment | IQSGKVGTDVKVSYRNFYNQLENVKLALQNFKYEIEIINL* |
| Ga0102813_11367252 | 3300009003 | Estuarine | KFGVDLKVSYREFYNKFELCKLALQNYKYEIEVI* |
| Ga0102826_10435171 | 3300009054 | Estuarine | IHDSRTHQTTIRITSGKFGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0102815_102719553 | 3300009080 | Estuarine | DSRTHQTTIRITSGKFGTDIKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0102884_10729932 | 3300009141 | Estuarine | SDKHQTTIRISCGKFGADIKVSYREFYNKFELCKLALQNYQHEIEVI* |
| Ga0114903_10670571 | 3300009412 | Deep Ocean | TIRIVSGKFGKDVKVSYKDFYNQLELCKSALQNYQHEIEVI* |
| Ga0114909_11679882 | 3300009414 | Deep Ocean | IRVKSGKVEADVKVSYKDFYDQLEKCKFAMTDCNYNLEII* |
| Ga0114994_101722851 | 3300009420 | Marine | TTIRISTGRFKIAVNVSYKDFYNQLELCKLALQNYQYEIEVI* |
| Ga0114994_107223641 | 3300009420 | Marine | QTTIRISTGRFKIAVNVSYKDFYNQLELCKLALQNYQYEIEII* |
| Ga0115564_105444281 | 3300009505 | Pelagic Marine | VSGKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0114900_11627431 | 3300009602 | Deep Ocean | SSKHQTTIRIVSGKFGKDVKVSYKDFYKQLKLCKLALQNYQHEIEVI* |
| Ga0114911_10576991 | 3300009603 | Deep Ocean | NSDKHQTTIRISCGKFGTDIKVSYREFYNKFELCKLALQNYQHEIEVI* |
| Ga0114911_11126161 | 3300009603 | Deep Ocean | NSDKHQTTIRISCGKFGTDIKVSYREFYNKFELCKLALQNYKYEIEVI* |
| Ga0114901_12072011 | 3300009604 | Deep Ocean | SSKHQTTIRIVSGKFGKDVKVSYKDFYNQLKLCKLALQNYQHEIEVI* |
| Ga0115001_105110931 | 3300009785 | Marine | EVGTDVKVSFRDFYNQLENVKLALQNFKYEIEIITL* |
| Ga0098049_10031301 | 3300010149 | Marine | IKITSGNVGVDIKVSYKDFYNQLELCKLALRDCNYNLEIL* |
| Ga0098056_11422531 | 3300010150 | Marine | RFTVAVNVSYKDFYNQLENVKLALQDYQFEIEIV* |
| Ga0098061_12315341 | 3300010151 | Marine | GGFGTDIKVSYRNFYNQLELCKLALQDYQFEIEIV* |
| Ga0118733_1065011462 | 3300010430 | Marine Sediment | LKHQTTIRISTGKFMIAVNVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0133547_112095041 | 3300010883 | Marine | GRFKIAVNVSYKDFYNQLELCKLALQNYQYEIEVI* |
| Ga0114922_106096541 | 3300011118 | Deep Subsurface | QTTIRIVSGQFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI* |
| Ga0181367_10404611 | 3300017703 | Marine | KNGIHDSSKHQTTIRISTGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181377_10696241 | 3300017706 | Marine | NGIHDSSKHQTTIRISTGKLGTDVKVSYKDCYNQLELCKLALQNYQHEIEVI |
| Ga0181388_11377892 | 3300017724 | Seawater | GKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181398_10813611 | 3300017725 | Seawater | HDSRTHQTTIRITSGKFGTDIKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181426_10292331 | 3300017733 | Seawater | IVSGKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181399_11774911 | 3300017742 | Seawater | TTIRIVSGKFGTDIKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181397_11592972 | 3300017744 | Seawater | KHQTTIRISTGKFKIAINVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181389_11727292 | 3300017746 | Seawater | DKHQTTIRIVSGKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181405_10815443 | 3300017750 | Seawater | IRIVSDKFGTDIKVSYRDFYNQLELCKLALQNYQHEIEVI |
| Ga0187219_10923841 | 3300017751 | Seawater | SKKHQTTIRISCGKFNTDVKVSYREFYNKFELCKLALQNYKYEIEVI |
| Ga0181382_11247772 | 3300017756 | Seawater | ITSGKVETDVKVSYKDFYKQLENCKLALVDCNYNLEII |
| Ga0181420_10861091 | 3300017757 | Seawater | IHDSSKHQTTIRIVSGKFGKDVKVSYKDFYNQLKLCKLALQNYQHEIEVI |
| Ga0181413_10624691 | 3300017765 | Seawater | TTIRIVSGKFGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181413_11542062 | 3300017765 | Seawater | FDSHKHQTTIRISCGKFRTDIKVSYREFDNKFELCKLALQNYKYEIEVI |
| Ga0181413_11836092 | 3300017765 | Seawater | RISCGKFRTDIKVSYREFDNKFELCKLALKNYKYEIEVI |
| Ga0181430_10137607 | 3300017772 | Seawater | HDSRTHQTTIRITSGKFGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0181386_11414712 | 3300017773 | Seawater | RIVSGKFGKDVKVSYKEFYNQLKLCKLALQNYQHEIEVI |
| Ga0181423_11435641 | 3300017781 | Seawater | GKFGVDLKVSYREFYNKFELCKLALQNYKYEIEVI |
| Ga0181424_102303851 | 3300017786 | Seawater | QTTIRISCGKFGANIKVSYREFYNKFELCKLALQNYKYEIEVI |
| Ga0206124_101713381 | 3300020175 | Seawater | ISCGKFGTDVKVSYREFYNKFELCKFALQNYKYEIEVI |
| Ga0206685_102198232 | 3300021442 | Seawater | TSGRSKVDIKVSYKDFYHQLELCKFALTDCNYNLEII |
| Ga0196889_10674222 | 3300022072 | Aqueous | KRYLKDNDIYDSKKHQTTIRISCGKFGVDIKVSYREFYNKFELCKLALQNYKYEIEVI |
| Ga0196887_10576973 | 3300022178 | Aqueous | SVKHQVTIRIKSGDVGTDIKVSYRDFYNQLENVKLALQNFKYEIEIITL |
| Ga0224503_101526741 | 3300022201 | Sediment | SCGKFGVDLKVSYREFYNKFELCKLALQNYKYEIEVI |
| Ga0224513_101567221 | 3300022220 | Sediment | HDSSKHQTTIRISTGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI |
| (restricted) Ga0233412_103709101 | 3300023210 | Seawater | IRITSGKFGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| (restricted) Ga0255050_101530991 | 3300024052 | Seawater | ISCGKFGADVKVSYREFYNKFELCKLALQNYKYEIEVI |
| (restricted) Ga0255044_104937602 | 3300024529 | Seawater | NDVVHSSKHQVTIRIQSGKVGTDIKVSFRNFYNQLENIKLALQNFKYDIEIITL |
| Ga0208668_10286481 | 3300025078 | Marine | STGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0208791_10721202 | 3300025083 | Marine | TIKITSGNVGVDIKVSYKDFYNQLELCKLALRDCNYNLEIL |
| Ga0208010_10368451 | 3300025097 | Marine | ISTGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0208793_11577362 | 3300025108 | Marine | STGKLGTDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0208553_11137322 | 3300025109 | Marine | QTTIRISTGKFKIAVNVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0208158_10259035 | 3300025110 | Marine | GNVGVDIKVSYKDFYNQLELCKLALRDCNYNLEIL |
| Ga0208158_10759552 | 3300025110 | Marine | SGKFGTDIKVSYRDFYNQLELCKLALQNYQHEIEVI |
| Ga0209348_10700591 | 3300025127 | Marine | AKHQTTIRITSGKLRKDIKVSYRDFYNQLELCKLALQNYIHEIKVI |
| Ga0209128_101458611 | 3300025131 | Marine | TTIRVTSGGFGTDIKVSYRNFYNQLELCKLALQDYQFEIEIV |
| Ga0209128_10200121 | 3300025131 | Marine | RVTSGGFGTDIKVSYRNFYNQLELCKLALQDYQFEIEIV |
| Ga0209128_11318761 | 3300025131 | Marine | TTIRIVSGKFGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0209232_10509064 | 3300025132 | Marine | TTIRITSGKLRKDIKVSYRDFYNQLELCKLALQNYIHEIKVI |
| Ga0209336_101314951 | 3300025137 | Marine | SGKVGTDIKLSYRDFYNQLENVKIALQNYKYETEIITL |
| Ga0209337_10825825 | 3300025168 | Marine | KSGKVGTDIKVSYRNFYNQLENVKLALQNFKYEIEIITL |
| Ga0209337_11489843 | 3300025168 | Marine | TIRIVSGKFGTDIKVSYKDFYNQLELCKLVLQNYQHEIEVI |
| Ga0209337_11625473 | 3300025168 | Marine | GKVEADIKVSYKDFYEQLEKCKFALTDCNYNLEIIND |
| Ga0208031_10489921 | 3300025237 | Deep Ocean | SIRIQSGEVGTDIKVSFRDFYNQLENVKLALQNFKYEIEIITL |
| Ga0208180_11055382 | 3300025277 | Deep Ocean | QTTIRIVSGKFGKDVKVSYKDFYKQLKLCKLALQNYQHEIEVI |
| Ga0208181_10629251 | 3300025300 | Deep Ocean | TIRIVSGKFGKDVKVSYKDFYKQLKLCKLALQNYQHEIEVI |
| Ga0209335_102358592 | 3300025894 | Pelagic Marine | IFDSDKHQTTIRISCGKFGTDVKVSYREFYNKFELCKFALQNYKYEIEVI |
| Ga0209815_12428292 | 3300027714 | Marine | LKDYLRKNDVVNSEKHQVTIRIQSGKVGTDIKVSYRNFYNQLENIKLALQNFKYDIEIIT |
| Ga0209379_100141669 | 3300027758 | Marine Sediment | HQVSIRIQSGDVGTDVKVSYRDFYNQLENVKLALQNFKYEIEVITL |
| Ga0209091_103258491 | 3300027801 | Marine | QTSIRIKSGKVGTDVKVSYRDFYNQLELCKLALQDYKFEIEII |
| (restricted) Ga0233415_100141978 | 3300027861 | Seawater | TIRIVSGKFGTDIKVSYKDFYNQLELCKLALQNYQHEIEVI |
| (restricted) Ga0233413_100870933 | 3300027996 | Seawater | GKYGKDVKVSYKDFYNQLELCKLALQNYQHEIEVI |
| Ga0308025_12946921 | 3300031143 | Marine | QSGEVGTDIKVSYRDFYNQLENVKLALQNFKYEIEIINL |
| Ga0307999_11478102 | 3300031608 | Marine | VFNSEKEQVIIRIKSGKVGTDVKVSYRNFYNQLENVKLALQNFKYDIEIITL |
| Ga0308009_103486071 | 3300031612 | Marine | DYLRKNDVVNSEKKQVIIRIKSGKVGTDIKVSYRNFYNQLENIKLALQNFKYEVEIITL |
| Ga0308005_100364434 | 3300031656 | Marine | VIIRIKSGKVGTDIKVSYRNFYNQLENIKLALQNFKYEVEIITL |
| Ga0307984_12072832 | 3300031658 | Marine | RIVAEVKLSYKDFYNQLEMIKLALENFQYETEIITL |
| Ga0307375_103298981 | 3300031669 | Soil | NHQTIIRITSGKVGTDVKVSYKDFYNQLENCKLALQNCNYNLEII |
| Ga0308011_102564492 | 3300031688 | Marine | SEKHQVIIRIQSGKVGTDVKVSYRNFYNQLENVKLALQNFKYDIEIITL |
| Ga0307998_10313137 | 3300031702 | Marine | VSIRIQSGEVGTDIKVSYRDFYNQLENVKLALQNFKYEIEIINL |
| Ga0315326_102779553 | 3300031775 | Seawater | SGRVEYDVKVSYKDFYNQLEKCKFAMTDCNYNLEII |
| Ga0315321_107433162 | 3300032088 | Seawater | DSEKHQTTIRISCGKFGVDIKVSYREFYNKFELCKLALQNYKYEIEVI |
| ⦗Top⦘ |