Metagenome / Metatranscriptome Family F087731

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F087731
Family Type	Metagenome / Metatranscriptome
Number of Sequences	110
Average Sequence Length	42 residues
Representative Sequence	LIKFTHTLVGPFPEDHRPRLASGWAALHARVRKAAEAATK
Number of Associated Samples	95
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.09 %
% of genes from short scaffolds (< 2000 bps)	90.91 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (82.727 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.818 % of family members)
Environment Ontology (ENVO)	Unclassified (39.091 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (52.727 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF05163	DinB	53.64
PF12867	DinB_2	21.82
PF07519	Tannase	3.64
PF04993	TfoX_N	1.82
PF07995	GSDH	1.82
PF01230	HIT	0.91
PF08282	Hydrolase_3	0.91
PF00291	PALP	0.91
PF13676	TIR_2	0.91
PF12836	HHH_3	0.91
PF05988	DUF899	0.91
PF13715	CarbopepD_reg_2	0.91
PF00535	Glycos_transf_2	0.91
PF07859	Abhydrolase_3	0.91
PF00571	CBS	0.91
PF07228	SpoIIE	0.91
PF01896	DNA_primase_S	0.91
PF00583	Acetyltransf_1	0.91
PF01436	NHL	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG2318	Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)	Secondary metabolites biosynthesis, transport and catabolism [Q]	53.64
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	1.82
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	1.82
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.91
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.91
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.91
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.91
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.91
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.91
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.73 %
Unclassified	root	N/A	17.27 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.73 %
Unclassified	root	N/A	17.27 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.73 %
Unclassified	root	N/A	17.27 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	18.18 %
Unclassified	root	N/A	17.27 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	5.45 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.27 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	8.18 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	5.45 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	1.82 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.82 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.91 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.27 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	8.18 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	5.45 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	1.82 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.91 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.27 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	8.18 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	5.45 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	1.82 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	0.91 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.91 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.27 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	5.45 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	3.64 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	1.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.91 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.91 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.27 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	5.45 %
Acidobacteriaceae bacterium KBS 89	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	3.64 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.91 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.91 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908045\|KansclcFeb2_ConsensusfromContig881330	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
2170459021\|G14TP7Y01BK21V	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	767	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0663185	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300000956\|JGI10216J12902_101364488	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300004156\|Ga0062589_102712823	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	516	Open in IMG/M
3300004157\|Ga0062590_100035520	All Organisms → cellular organisms → Bacteria	2589	Open in IMG/M
3300004463\|Ga0063356_104101024	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300004463\|Ga0063356_105129284	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300004643\|Ga0062591_100821639	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	860	Open in IMG/M
3300005289\|Ga0065704_10488384	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300005330\|Ga0070690_101200994	All Organisms → cellular organisms → Bacteria → Acidobacteria	605	Open in IMG/M
3300005332\|Ga0066388_100404421	All Organisms → cellular organisms → Bacteria	2010	Open in IMG/M
3300005343\|Ga0070687_100357587	Not Available	944	Open in IMG/M
3300005353\|Ga0070669_100133288	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1909	Open in IMG/M
3300005366\|Ga0070659_100203781	All Organisms → cellular organisms → Bacteria	1629	Open in IMG/M
3300005441\|Ga0070700_101114296	All Organisms → cellular organisms → Bacteria → Acidobacteria	655	Open in IMG/M
3300005455\|Ga0070663_100827182	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300005543\|Ga0070672_101353975	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	636	Open in IMG/M
3300005545\|Ga0070695_101501493	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	561	Open in IMG/M
3300005548\|Ga0070665_102354093	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300005557\|Ga0066704_10386004	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300005564\|Ga0070664_100136615	All Organisms → cellular organisms → Bacteria	2156	Open in IMG/M
3300005615\|Ga0070702_101508581	Not Available	553	Open in IMG/M
3300005618\|Ga0068864_102081729	Not Available	574	Open in IMG/M
3300005764\|Ga0066903_100465039	All Organisms → cellular organisms → Bacteria	2123	Open in IMG/M
3300005764\|Ga0066903_103627101	All Organisms → cellular organisms → Bacteria	831	Open in IMG/M
3300006049\|Ga0075417_10655652	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	537	Open in IMG/M
3300006169\|Ga0082029_1031949	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300006844\|Ga0075428_100329353	All Organisms → cellular organisms → Bacteria	1640	Open in IMG/M
3300006845\|Ga0075421_100926779	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	992	Open in IMG/M
3300006847\|Ga0075431_101383016	All Organisms → cellular organisms → Bacteria → Acidobacteria	664	Open in IMG/M
3300006854\|Ga0075425_102910100	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300006880\|Ga0075429_101502242	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	586	Open in IMG/M
3300006881\|Ga0068865_100521047	All Organisms → cellular organisms → Bacteria	994	Open in IMG/M
3300006904\|Ga0075424_101677851	Not Available	673	Open in IMG/M
3300006953\|Ga0074063_14133516	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	661	Open in IMG/M
3300006953\|Ga0074063_14172323	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	551	Open in IMG/M
3300006953\|Ga0074063_14262837	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	581	Open in IMG/M
3300006969\|Ga0075419_10455209	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300006969\|Ga0075419_10675323	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	731	Open in IMG/M
3300007004\|Ga0079218_10451028	All Organisms → cellular organisms → Bacteria	1117	Open in IMG/M
3300009098\|Ga0105245_11213999	Not Available	802	Open in IMG/M
3300009100\|Ga0075418_10021744	All Organisms → cellular organisms → Bacteria → Acidobacteria	7064	Open in IMG/M
3300009101\|Ga0105247_10732267	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300009162\|Ga0075423_10001891	All Organisms → cellular organisms → Bacteria	18803	Open in IMG/M
3300009176\|Ga0105242_10151090	All Organisms → cellular organisms → Bacteria	2025	Open in IMG/M
3300009176\|Ga0105242_10520985	All Organisms → cellular organisms → Bacteria	1134	Open in IMG/M
3300009176\|Ga0105242_12914695	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300009789\|Ga0126307_10582699	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300009789\|Ga0126307_10788291	All Organisms → cellular organisms → Bacteria	767	Open in IMG/M
3300010362\|Ga0126377_12428532	Not Available	600	Open in IMG/M
3300010397\|Ga0134124_11471666	Not Available	708	Open in IMG/M
3300010403\|Ga0134123_11013246	Not Available	847	Open in IMG/M
3300011333\|Ga0127502_10156660	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	506	Open in IMG/M
3300012189\|Ga0137388_11848407	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300012211\|Ga0137377_11337689	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300012469\|Ga0150984_108539423	Not Available	558	Open in IMG/M
3300012493\|Ga0157355_1017890	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300012988\|Ga0164306_11471944	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	582	Open in IMG/M
3300014325\|Ga0163163_11063992	Not Available	872	Open in IMG/M
3300014326\|Ga0157380_13151825	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	526	Open in IMG/M
3300015200\|Ga0173480_10402211	Not Available	795	Open in IMG/M
3300015371\|Ga0132258_10280449	All Organisms → cellular organisms → Bacteria → Acidobacteria	4089	Open in IMG/M
3300015373\|Ga0132257_104553078	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300015374\|Ga0132255_100258891	All Organisms → cellular organisms → Bacteria	2489	Open in IMG/M
3300015374\|Ga0132255_104359987	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300018073\|Ga0184624_10528610	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300018469\|Ga0190270_11642371	All Organisms → cellular organisms → Bacteria	695	Open in IMG/M
3300018469\|Ga0190270_13027415	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300019458\|Ga0187892_10114820	All Organisms → cellular organisms → Bacteria	1575	Open in IMG/M
3300021081\|Ga0210379_10433962	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	582	Open in IMG/M
3300021082\|Ga0210380_10402020	Not Available	627	Open in IMG/M
3300022880\|Ga0247792_1059311	Not Available	729	Open in IMG/M
3300025900\|Ga0207710_10428417	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300025904\|Ga0207647_10535026	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300025918\|Ga0207662_10299211	All Organisms → cellular organisms → Bacteria	1069	Open in IMG/M
3300025924\|Ga0207694_10371345	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1186	Open in IMG/M
3300025925\|Ga0207650_10151802	All Organisms → cellular organisms → Bacteria	1829	Open in IMG/M
3300025926\|Ga0207659_10408305	All Organisms → cellular organisms → Bacteria	1137	Open in IMG/M
3300025926\|Ga0207659_11242298	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300025937\|Ga0207669_11129359	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300025938\|Ga0207704_11651245	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300025960\|Ga0207651_11955881	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	527	Open in IMG/M
3300026023\|Ga0207677_11120764	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300026118\|Ga0207675_101803651	Not Available	631	Open in IMG/M
3300027903\|Ga0209488_10611332	Not Available	790	Open in IMG/M
3300028381\|Ga0268264_11193362	Not Available	770	Open in IMG/M
3300028708\|Ga0307295_10136396	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300028778\|Ga0307288_10220492	Not Available	736	Open in IMG/M
3300028802\|Ga0307503_10051042	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1578	Open in IMG/M
3300028803\|Ga0307281_10198084	All Organisms → cellular organisms → Bacteria	722	Open in IMG/M
3300031198\|Ga0307500_10062268	All Organisms → cellular organisms → Bacteria	928	Open in IMG/M
3300031229\|Ga0299913_11000180	All Organisms → cellular organisms → Bacteria	803	Open in IMG/M
3300031231\|Ga0170824_102090862	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300031231\|Ga0170824_106506541	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300031366\|Ga0307506_10511115	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300031562\|Ga0310886_10292878	All Organisms → cellular organisms → Bacteria → Acidobacteria	927	Open in IMG/M
3300031858\|Ga0310892_10357289	All Organisms → cellular organisms → Bacteria	939	Open in IMG/M
3300031858\|Ga0310892_11362948	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300031911\|Ga0307412_10421736	All Organisms → cellular organisms → Bacteria	1092	Open in IMG/M
3300031913\|Ga0310891_10241193	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300031943\|Ga0310885_10679142	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	577	Open in IMG/M
3300032000\|Ga0310903_10366825	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300032075\|Ga0310890_10594894	All Organisms → cellular organisms → Bacteria	855	Open in IMG/M
3300032144\|Ga0315910_11181988	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300032144\|Ga0315910_11586751	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300032421\|Ga0310812_10583764	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300033551\|Ga0247830_10566781	All Organisms → cellular organisms → Bacteria → Acidobacteria	897	Open in IMG/M
3300034669\|Ga0314794_128687	Not Available	569	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	56.36%
Host-Associated	Host-Associated	42.73%
Engineered	Engineered	0.91%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.73%
Plants	Host-Associated → Plants	42.73%
Aquatic	Environmental → Aquatic	3.64%
Solid Waste	Engineered → Solid Waste	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	29.09%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.73%
Freshwater	Environmental → Aquatic → Freshwater	2.73%
Sediment	Environmental → Aquatic → Sediment	0.91%
Cave	Environmental → Terrestrial → Cave	0.91%
Roots	Host-Associated → Plants → Roots	0.91%
Grass	Engineered → Solid Waste → Grass	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.18%
Soil	Host-Associated → Plants → Rhizosphere → Soil	10.91%
Loam	Environmental → Terrestrial → Soil → Loam	8.18%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.18%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.55%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.82%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.91%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.91%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.91%
Composting	Engineered → Solid Waste → Grass → Composting	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	10.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	8.18%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.18%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.45%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.55%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.64%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.73%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.82%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.91%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.91%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.91%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.82%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	8.18%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.64%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.73%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.73%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.73%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.73%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.73%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.73%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.82%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.82%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.82%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.82%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.91%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.91%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.91%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.91%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.91%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental	Open in IMG/M
2170459021	Litter degradation NP4	Engineered	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012493	Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034669	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
KansclcFeb2_04026570	2124908045	Soil	THTVVGPFPEDHRSQLALGWTALHARVRKAAESAAE
4NP_00163690	2170459021	Switchgrass, Maize And Mischanthus Litter	TLIKFTHTXVGPSPEDPATAARAGWAALHARVRKAAETAAK
ICChiseqgaiiDRAFT_06631852	3300000033	Soil	KFXHTVVGPFPDENRPHMANGWSAMHARVRKAAESAASQED*
JGI10216J12902_1013644881	3300000956	Soil	HTVVGPFPEDHRPQMASGWTALHARVRKAAEAAA*
Ga0062589_1027128231	3300004156	Soil	EQGSLITFKHTLVGPFPEDQRPHLGRGWAAMHARVRKAAEAGAGR*
Ga0062590_1000355205	3300004157	Soil	TLITFTHTLVGPFPEEHRSRMASGWNALHARVRNAAEAATR*
Ga0063356_1041010242	3300004463	Arabidopsis Thaliana Rhizosphere	KFTHTVAGPFPEDHRPRMASGWTALHARVRKAAESAAAQEDR*
Ga0063356_1051292841	3300004463	Arabidopsis Thaliana Rhizosphere	SETPDGTLIKFTHTVVGPFPEENRSLMATGWSAMHARVRKAAEAEGH*
Ga0062591_1008216391	3300004643	Soil	VDDGSLITFTHTLVGPVPEDHRPQLAKGWAALHARVRQAAEDHNR*
Ga0065704_104883842	3300005289	Switchgrass Rhizosphere	TLIKFTHTLVGPFPEEHRPRLGSGWAALHERVRKAAEDAAR*
Ga0070690_1012009941	3300005330	Switchgrass Rhizosphere	ETPEGTLIKFRHTVVGPFPDENRPLMASGWSAMHARVRKAAEAEAH*
Ga0066388_1004044211	3300005332	Tropical Forest Soil	LIKFTHTVVGPFPEDHRPRLASGWAALHARVRKAAEAAGEAGL*
Ga0070687_1003575872	3300005343	Switchgrass Rhizosphere	TLIRFTHTLVGPFPEDHRPRLATGWSALHARVRKAAEAAAS*
Ga0070669_1001332881	3300005353	Switchgrass Rhizosphere	LIKFTHTVVGPFPEENRPHMAIGWTAMHARVRKAAEAAEN*
Ga0070659_1002037811	3300005366	Corn Rhizosphere	ETPDGTLIKFTHTLVGPFPEDHRPRLATGWSALHARVRTAAEAAAS*
Ga0070700_1011142962	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	DGTLIKFTHTVVGPFPDDNRPQLASGWAALHARVRKAAEAAAQ*
Ga0070663_1008271821	3300005455	Corn Rhizosphere	SDGTLIKFTHTLVGPFPEEHRSRLKSGWSALHARVRKAAEAAAQ*
Ga0070672_1013539752	3300005543	Miscanthus Rhizosphere	DFRHTVVGPFPEEHRTPLGTGWKSMHARVKRVAEATAARK*
Ga0070695_1015014931	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	LIKFTHTLVGPFPEDHRPRLASGWAALHARVRKAAEAATK*
Ga0070665_1023540932	3300005548	Switchgrass Rhizosphere	LIKFTHTLTGPFPEDHRPRMLSGWSAMHARVRKAAEAAEN*
Ga0066704_103860041	3300005557	Soil	FTHTLVGPFPEDHRSRLGSGWAALHARVRTAAEAVGGE*
Ga0070664_1001366153	3300005564	Corn Rhizosphere	DGSLITFTHTLVGPFPEEHRSRLKSGWSALHARVRKAAEAAAQ*
Ga0070702_1015085811	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	IKFTHTVVGPFPEDHRPKLASGWAAMHARVRRAAEADEK*
Ga0068864_1020817292	3300005618	Switchgrass Rhizosphere	HTLVGPFPEEHRSRLGSGWTALHARVRKAAEAAR*
Ga0066903_1004650391	3300005764	Tropical Forest Soil	IKFTHTLVGPFPEEHRSRLGSGWAALHERVRKAAEDAAR*
Ga0066903_1036271011	3300005764	Tropical Forest Soil	SFTHTLVGPFPDDQRPHLATGWTALHARVRAAAEGR*
Ga0075417_106556522	3300006049	Populus Rhizosphere	HTLVGPFPEEHRSRLGSGWTALHARVRKAAEATR*
Ga0082029_10319492	3300006169	Termite Nest	FTHTLIGPFPEDHRPGLTTGWTALHARVRKAAEAAGR*
Ga0075428_1003293533	3300006844	Populus Rhizosphere	DGTIIKFRQTVVGPFPEENRPLMAAGWTAMHARVRKAAEAEAD*
Ga0075421_1009267791	3300006845	Populus Rhizosphere	RLTETSEGTVIKFTHTVVGPFPEDHQPRLAAGWTALHARVRKAAEATAN*
Ga0075431_1013830162	3300006847	Populus Rhizosphere	LIKFTHTLLGPFPEDHRPQLAAGWAELHARVRKAAEAGN*
Ga0075425_1029101002	3300006854	Populus Rhizosphere	TVVGPFPDDNRPQLASGWAALHARVRKAAEAAAL*
Ga0075429_1015022421	3300006880	Populus Rhizosphere	TLITFTHTCVGPMPEDMQGDLGSGWAAMHARVKQAAEKQGDRQ*
Ga0068865_1005210471	3300006881	Miscanthus Rhizosphere	RLSETPEGTLIKFRHTVVGPFPDENRPLMASGWSAMHARVRKAAEAEAH*
Ga0075424_1016778511	3300006904	Populus Rhizosphere	FRHTVVGPFPDENRPHMANGWSAMHARVRKAAESAANQED*
Ga0074063_141335162	3300006953	Soil	IKFTHTLAGPFPEEHRPRLGSGWAALHERVRKAAEDAAR*
Ga0074063_141723232	3300006953	Soil	RLSETPEGTLIQFTHTVVGPFPDDNRPRLATGWAALHARVRKAAEAAAR*
Ga0074063_142628371	3300006953	Soil	TPDGTVIKFTHTLVGPFPEDHRSRLTAGWSALHARVRKAAEAATN*
Ga0075419_104552092	3300006969	Populus Rhizosphere	TLIKFTHTLVGPFPEEHRSRLKSGWSALHARVRKAAEAAAQ*
Ga0075419_106753233	3300006969	Populus Rhizosphere	LIKFVHTLVGPFPEDHRSGLGSGWTALHARVRKAAEAA*
Ga0079218_104510281	3300007004	Agricultural Soil	EIPEGVLITFTHTLVGPFPEEHRPRLTSGWAALHARVRQAAEAAAN*
Ga0105245_112139993	3300009098	Miscanthus Rhizosphere	IKFTHTLVGPFPEDHRSQLSSGWTALHARVRKAAEAAAN*
Ga0075418_100217441	3300009100	Populus Rhizosphere	EGTLIKFTHTVVGPFPEDHQPRLAAGWTALHARVRKAAEATAN*
Ga0105247_107322671	3300009101	Switchgrass Rhizosphere	TLIKFTHTLVGPFPEDHRPRLASGWAALHARVRKAAETAAK*
Ga0075423_100018911	3300009162	Populus Rhizosphere	HTVVGPFPEDHRPKLASGWAALHARVRKAAEADGK*
Ga0105242_101510903	3300009176	Miscanthus Rhizosphere	FTPRLVGPFPEEHRPRIGSGWAALHERVRKAAEDAAR*
Ga0105242_105209853	3300009176	Miscanthus Rhizosphere	YRLTETPEGSLIKFTHTLVGPFPDDHRPQIATGWTALHARVRKAAEASAK*
Ga0105242_129146952	3300009176	Miscanthus Rhizosphere	PEGTLIKFRHTVVGPFPDENRPLMASGWSAMHARVRKADEAEAH*
Ga0126307_105826993	3300009789	Serpentine Soil	RSLLSETDDGTVIAFTHTLVGPFPEDHRSQLGTGWAAMHARVRAAAETPERQ*
Ga0126307_107882911	3300009789	Serpentine Soil	HTLVGPFPEDHRPQLATGWSALHARVRAAAEAAGK*
Ga0126377_124285321	3300010362	Tropical Forest Soil	HTLVGPFPEDHRSMLASGWTALHARVRKAAEAATTK*
Ga0134124_114716661	3300010397	Terrestrial Soil	TLIKFTHTLVGPFPEEHRSRLGSGWAALHERVRKAAEDAAR*
Ga0134123_110132461	3300010403	Terrestrial Soil	HRLVGPFPEEHRPRIGSGWAALHERVRKAAEDAAR*
Ga0127502_101566602	3300011333	Soil	FKHTVVGPFPEEHRAQLASGWAVMHARVRKAAEEGL*
Ga0137388_118484072	3300012189	Vadose Zone Soil	LITFTHTLVGPFPEDHRPRLATGWAALHARVRAAAEAAGK*
Ga0137377_113376891	3300012211	Vadose Zone Soil	TESDEGTLISFTHTLVGPFPEDHRSQLGTGWAALHARVRAAAEGR*
Ga0150984_1085394232	3300012469	Avena Fatua Rhizosphere	LINFTHTLVGPFPEEHRPRLSSGWTALHARVRKAAEAGTAS*
Ga0157355_10178902	3300012493	Unplanted Soil	KFTHTVVGPFPEDHRPRLASGWAALHARVRKAAEANA*
Ga0164306_114719442	3300012988	Soil	LSETPEGTLIKFTHTVVGPFPDDNRPQLASGWAALHARVRKAAEAAAL*
Ga0163163_110639921	3300014325	Switchgrass Rhizosphere	TVVGPFPDDHRPGLTMGWTALHARVRKAAESAAR*
Ga0157380_131518251	3300014326	Switchgrass Rhizosphere	KFTHTLVGPFPEDHRSQLSSGWTALHARVRKAAEAAAN*
Ga0173480_104022113	3300015200	Soil	PEGTLIKFTHTVVGPFPDDNRPRVASGWAALHARVRKAAEAAAQ*
Ga0132258_102804491	3300015371	Arabidopsis Rhizosphere	TLIKFSHKLGGPFPEEHRSGLATGWTAMHARVRKAAEAAQ*
Ga0132257_1045530781	3300015373	Arabidopsis Rhizosphere	TVVGPFPDDHRSPLASGWTALHARVRKAAEAAAE*
Ga0132255_1002588914	3300015374	Arabidopsis Rhizosphere	LTEAPEGTLIKFTHTVVGPFPEDHRPRLASGWAALHARVRKAAEAGK*
Ga0132255_1043599872	3300015374	Arabidopsis Rhizosphere	VVGPFPDDHRPGMGAGWTAMHARVRKAAESPNRQV*
Ga0184624_105286102	3300018073	Groundwater Sediment	THTLVGPFPEEHRSRLGSGWTALHARVRKAAEATR
Ga0190270_116423711	3300018469	Soil	IPEGTLMTFTHTLVGPFPEEHRPRLTSGWAALHARVRKAADADAN
Ga0190270_130274152	3300018469	Soil	EGTLIKFTHTLVGPFPDDHRPRLSSGWSALHARVRNAAEAAAD
Ga0187892_101148201	3300019458	Bio-Ooze	LSETPEGTLIKFTHTLVGPFPEDYRQRLAPGWAVLHARVRKAAEAAAE
Ga0210379_104339621	3300021081	Groundwater Sediment	TFTHTLVGPFPEDHRPQLGTGWAALHARVRKAAETNGGE
Ga0210380_104020201	3300021082	Groundwater Sediment	FKHTLVGPFPEDHRPQLITGWAAMHARVRKAAETGAE
Ga0247792_10593111	3300022880	Soil	SGGGTLITFTHTCVGPMPEDMQGDLGSGWAAMHARVKQAAEMQGGRQ
Ga0207710_104284172	3300025900	Switchgrass Rhizosphere	RLRETSDGTLIKFTHTLVGPFPEEHRSRLKSGWSALHARVRKAAEAAAQ
Ga0207647_105350261	3300025904	Corn Rhizosphere	TLMKFTNTLVGPFPEEHRSQLATGWSALHARVRKAAEAVN
Ga0207662_102992113	3300025918	Switchgrass Rhizosphere	SETPEGTLIKFTHTVVGPFPDDNRPQLASGWAALHARVRKAAEAAAL
Ga0207694_103713451	3300025924	Corn Rhizosphere	IKFTHTLVGPFPDEHRSRLASGWGALHVRVRKAAEAGQERL
Ga0207650_101518021	3300025925	Switchgrass Rhizosphere	VVGPFPDENRPHMANGWSAMHARVRKAAESAASQED
Ga0207659_104083053	3300025926	Miscanthus Rhizosphere	EVEDGSLIKFTHTLVGPFPEDHRSQLGTGWTALHARVRKAAEADGGE
Ga0207659_112422982	3300025926	Miscanthus Rhizosphere	TLVGPFPEDHRPQLGTGWKALHQRVRQAAERGGKEK
Ga0207669_111293592	3300025937	Miscanthus Rhizosphere	IKFTHTLVGPFPEEHRSRLGSGWAALHERVRKAAEDAAR
Ga0207704_116512451	3300025938	Miscanthus Rhizosphere	MYRLSETPEGTLIEFRHTVVGPFPDENRPLMASGWSAMHARVRKAAEAEAH
Ga0207651_119558811	3300025960	Switchgrass Rhizosphere	HTVVGPFPEEHRTPLGTGWKSMHARVKRVAEATAARK
Ga0207677_111207641	3300026023	Miscanthus Rhizosphere	MPEGTLIKFTHTVVGPFPEDHRPKLASGWAAMHARVRRAAEADEK
Ga0207675_1018036512	3300026118	Switchgrass Rhizosphere	HTVFGPFPEDHRPQMGAGWAALHARVRAAAEAAAGN
Ga0209488_106113321	3300027903	Vadose Zone Soil	TPEGTLIKFTHTLVGPFPEDHRPRLSSGWSALHVRVRKAAEAAAK
Ga0268264_111933622	3300028381	Switchgrass Rhizosphere	IKFTHTVVGPFPDDHRTPLAVGWTALHARVRKAAEAAAE
Ga0307295_101363961	3300028708	Soil	SEGTLISFTHTLVGPFPEDHRSQLGTGWAALHARVRQAAEAAGK
Ga0307288_102204922	3300028778	Soil	EDGGTLISFTQTVVGPFPEDHRPQMGAGWGALHARVRAAAERSAGSGR
Ga0307503_100510421	3300028802	Soil	PEGTLIRFTHTLVGPFPEEHHPGLTKGWSALHARVRKAAESATSQEVI
Ga0307281_101980841	3300028803	Soil	ITFTHTLVGPFPEDHRPQLGTGWTALHARVRKAAETNGGE
Ga0307500_100622683	3300031198	Soil	SETPDGTLIKFTHTVVGPFPEENRPHMAIGWTAMHARVRKAAEAAEN
Ga0299913_105752623	3300031229	Soil	LYRLSEIPEGTFITFTHTLVGPFPEEHQPRLTSGWAALHARVRKAAEADAK
Ga0299913_110001803	3300031229	Soil	EAEGGTRISFTHTLVGPFPEDQQSALGSGWAALHARVRTAAEAAHGE
Ga0170824_1020908622	3300031231	Forest Soil	IKFTHTLVGPFPDDHRSRLGSGWTALHARVRKAAEAGEK
Ga0170824_1065065411	3300031231	Forest Soil	THTLVGPFPEDRRPHLSKGWTALHARVRQAAEGRDKG
Ga0307506_105111151	3300031366	Soil	HTLVGPFPDDHRPRLSTGWTALHARVRKAAEAAAK
Ga0310886_102928781	3300031562	Soil	EGTLIKFRQTVVGPFPEENRPHMAKGWSAMHARVRKAAEAEAHQEDRHEHH
Ga0310892_103572891	3300031858	Soil	INFTHTLVGPFPEDHRSQLGTGWTALHARVRKAAEADGGQE
Ga0310892_113629482	3300031858	Soil	EGTLIKFRHTVVGPFPDENRPLMASGWSAMHARVRKAAEAEAH
Ga0307412_104217361	3300031911	Rhizosphere	AVISFTHTLVGPFPEDHRPRLRSGWTALHARVRIAAEAALNKEVR
Ga0310891_102411932	3300031913	Soil	LMYRLSETPDGSLIKFSHTLVGPFPEEHRSRMAAGWTALHTRVRKAAEAAAK
Ga0310885_106791421	3300031943	Soil	TTVITFTHTVVGPLPEDHRPQMGAGWAALHARVRAAAEGK
Ga0310903_103668251	3300032000	Soil	GSLIKFSHTLVGPFPEEHRSRMAAGWTALHTRVRKAAEAAAK
Ga0310890_105948941	3300032075	Soil	IKFRHTVVGPFPDENRPHMANGWSAMHARVRKAAESAASQED
Ga0315910_111819882	3300032144	Soil	VFYRLSETPEGTLISFRHTLVGPFPEEYRPRLGSGWVALHARVRKAAESAEN
Ga0315910_115867511	3300032144	Soil	GTLIKFRHTVVGPFPEENRPHMANGWSAMHARVRKAAESAASQED
Ga0310812_105837642	3300032421	Soil	PDGTLIKFTHTLVGPFPEEHRSRLKSGWSALHARVRKAAEAAAQ
Ga0247830_105667811	3300033551	Soil	IKFTHTVVGPFPEDHRPRMGTGWAALHARVRKDAEAEAHSEARHEDH
Ga0314794_128687_454_567	3300034669	Soil	RHSLVGPPPGDDHSRMGSGWTALHARVRSAAEAGGDD

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F087731

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences