| Basic Information | |
|---|---|
| Family ID | F087729 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MARRFLSKLTRSLTAEWTPDAGVHFHGGAHGRPYPCHDPRCTSPGLDVSER |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.45 % |
| % of genes near scaffold ends (potentially truncated) | 39.09 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (20.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00392 | GntR | 23.64 |
| PF00933 | Glyco_hydro_3 | 22.73 |
| PF07729 | FCD | 16.36 |
| PF01425 | Amidase | 2.73 |
| PF03737 | RraA-like | 1.82 |
| PF00155 | Aminotran_1_2 | 1.82 |
| PF14310 | Fn3-like | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 22.73 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 16.36 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 16.36 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.73 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.18 % |
| Unclassified | root | N/A | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005329|Ga0070683_100576101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1077 | Open in IMG/M |
| 3300005337|Ga0070682_100403336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1035 | Open in IMG/M |
| 3300005338|Ga0068868_100849696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 827 | Open in IMG/M |
| 3300005338|Ga0068868_102007619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 549 | Open in IMG/M |
| 3300005345|Ga0070692_10561521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 749 | Open in IMG/M |
| 3300005347|Ga0070668_101134366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 707 | Open in IMG/M |
| 3300005354|Ga0070675_100474225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1125 | Open in IMG/M |
| 3300005364|Ga0070673_100644401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 969 | Open in IMG/M |
| 3300005365|Ga0070688_101122668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 629 | Open in IMG/M |
| 3300005366|Ga0070659_101400077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 622 | Open in IMG/M |
| 3300005367|Ga0070667_101479228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 638 | Open in IMG/M |
| 3300005438|Ga0070701_10238153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1093 | Open in IMG/M |
| 3300005459|Ga0068867_100521653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1024 | Open in IMG/M |
| 3300005564|Ga0070664_102346301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 506 | Open in IMG/M |
| 3300005564|Ga0070664_102391394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 501 | Open in IMG/M |
| 3300005616|Ga0068852_102436954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 544 | Open in IMG/M |
| 3300006169|Ga0082029_1071698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
| 3300006755|Ga0079222_10229922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1146 | Open in IMG/M |
| 3300006806|Ga0079220_11253586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 617 | Open in IMG/M |
| 3300006844|Ga0075428_102338119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 550 | Open in IMG/M |
| 3300006845|Ga0075421_102172547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 587 | Open in IMG/M |
| 3300006846|Ga0075430_101033338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 677 | Open in IMG/M |
| 3300006871|Ga0075434_101786266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 622 | Open in IMG/M |
| 3300006876|Ga0079217_10085057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
| 3300006894|Ga0079215_10747627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. SYSU D00693 | 671 | Open in IMG/M |
| 3300006918|Ga0079216_11868058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 518 | Open in IMG/M |
| 3300006954|Ga0079219_12493343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 503 | Open in IMG/M |
| 3300009100|Ga0075418_11695099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 687 | Open in IMG/M |
| 3300009100|Ga0075418_11696860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 687 | Open in IMG/M |
| 3300009100|Ga0075418_12286393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 590 | Open in IMG/M |
| 3300009148|Ga0105243_10446446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
| 3300009156|Ga0111538_11495946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 851 | Open in IMG/M |
| 3300009156|Ga0111538_11573561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 828 | Open in IMG/M |
| 3300009789|Ga0126307_10036456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3805 | Open in IMG/M |
| 3300009789|Ga0126307_10062640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2918 | Open in IMG/M |
| 3300009789|Ga0126307_10259303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1397 | Open in IMG/M |
| 3300009840|Ga0126313_10011307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 5647 | Open in IMG/M |
| 3300009840|Ga0126313_10011613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 5590 | Open in IMG/M |
| 3300009840|Ga0126313_10469077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1005 | Open in IMG/M |
| 3300010036|Ga0126305_10207901 | Not Available | 1244 | Open in IMG/M |
| 3300010036|Ga0126305_10660435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 705 | Open in IMG/M |
| 3300010037|Ga0126304_10650980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 711 | Open in IMG/M |
| 3300010038|Ga0126315_10582489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 721 | Open in IMG/M |
| 3300010039|Ga0126309_10216639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1068 | Open in IMG/M |
| 3300010039|Ga0126309_10290329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
| 3300010039|Ga0126309_10857849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 598 | Open in IMG/M |
| 3300010039|Ga0126309_11200367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 521 | Open in IMG/M |
| 3300010040|Ga0126308_10028727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3083 | Open in IMG/M |
| 3300010040|Ga0126308_10308946 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300010040|Ga0126308_10359487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 966 | Open in IMG/M |
| 3300010040|Ga0126308_10445062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 869 | Open in IMG/M |
| 3300010042|Ga0126314_10653915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 769 | Open in IMG/M |
| 3300010044|Ga0126310_10269424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1158 | Open in IMG/M |
| 3300010044|Ga0126310_10971808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 667 | Open in IMG/M |
| 3300010045|Ga0126311_10078107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2215 | Open in IMG/M |
| 3300010045|Ga0126311_11610896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 546 | Open in IMG/M |
| 3300010371|Ga0134125_11312247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 790 | Open in IMG/M |
| 3300010399|Ga0134127_10508169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300010399|Ga0134127_10812287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 985 | Open in IMG/M |
| 3300010403|Ga0134123_11526496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 713 | Open in IMG/M |
| 3300012212|Ga0150985_108513830 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300013296|Ga0157374_12430308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 551 | Open in IMG/M |
| 3300014745|Ga0157377_10269723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1111 | Open in IMG/M |
| 3300018422|Ga0190265_10553879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1266 | Open in IMG/M |
| 3300018422|Ga0190265_11023803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 947 | Open in IMG/M |
| 3300018422|Ga0190265_13479962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 525 | Open in IMG/M |
| 3300018429|Ga0190272_11382535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 706 | Open in IMG/M |
| 3300018432|Ga0190275_10113637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2428 | Open in IMG/M |
| 3300018432|Ga0190275_12574631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 586 | Open in IMG/M |
| 3300018466|Ga0190268_11547217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 580 | Open in IMG/M |
| 3300018469|Ga0190270_10072437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2514 | Open in IMG/M |
| 3300018469|Ga0190270_11051453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 844 | Open in IMG/M |
| 3300018469|Ga0190270_13457176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 501 | Open in IMG/M |
| 3300018476|Ga0190274_10945180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 932 | Open in IMG/M |
| 3300018476|Ga0190274_12276201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 639 | Open in IMG/M |
| 3300019356|Ga0173481_10166266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 925 | Open in IMG/M |
| 3300019377|Ga0190264_10377233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 906 | Open in IMG/M |
| 3300020070|Ga0206356_11279603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 721 | Open in IMG/M |
| 3300020078|Ga0206352_10307054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 521 | Open in IMG/M |
| 3300020082|Ga0206353_10527767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 815 | Open in IMG/M |
| 3300020181|Ga0196958_10003428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4711 | Open in IMG/M |
| 3300021184|Ga0196959_10159804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 557 | Open in IMG/M |
| 3300025931|Ga0207644_11084292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 673 | Open in IMG/M |
| 3300025932|Ga0207690_11157058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 645 | Open in IMG/M |
| 3300025935|Ga0207709_10666031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 830 | Open in IMG/M |
| 3300025935|Ga0207709_11341609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 592 | Open in IMG/M |
| 3300025945|Ga0207679_11103578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 728 | Open in IMG/M |
| 3300025961|Ga0207712_11113477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 703 | Open in IMG/M |
| 3300025972|Ga0207668_10922517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 778 | Open in IMG/M |
| 3300026023|Ga0207677_11115693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 719 | Open in IMG/M |
| 3300027909|Ga0209382_11701808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 619 | Open in IMG/M |
| 3300028589|Ga0247818_11391174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 506 | Open in IMG/M |
| 3300028722|Ga0307319_10172355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 705 | Open in IMG/M |
| 3300028812|Ga0247825_10729315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 714 | Open in IMG/M |
| 3300030336|Ga0247826_10274826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1195 | Open in IMG/M |
| 3300030336|Ga0247826_10328063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1107 | Open in IMG/M |
| 3300030336|Ga0247826_11536552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 540 | Open in IMG/M |
| 3300031229|Ga0299913_10515095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1182 | Open in IMG/M |
| 3300031824|Ga0307413_11659542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 569 | Open in IMG/M |
| 3300031852|Ga0307410_10789112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 807 | Open in IMG/M |
| 3300031901|Ga0307406_10590203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 915 | Open in IMG/M |
| 3300031901|Ga0307406_11831272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 540 | Open in IMG/M |
| 3300031911|Ga0307412_11454516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 622 | Open in IMG/M |
| 3300031911|Ga0307412_12064607 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031995|Ga0307409_102693201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 525 | Open in IMG/M |
| 3300032005|Ga0307411_11298321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 663 | Open in IMG/M |
| 3300032080|Ga0326721_10089708 | Not Available | 1444 | Open in IMG/M |
| 3300032126|Ga0307415_100643122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 950 | Open in IMG/M |
| 3300032126|Ga0307415_102436598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 515 | Open in IMG/M |
| 3300034666|Ga0314788_137283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 20.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 9.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070683_1005761012 | 3300005329 | Corn Rhizosphere | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0070682_1004033361 | 3300005337 | Corn Rhizosphere | LSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0068868_1008496961 | 3300005338 | Miscanthus Rhizosphere | MARRFLSKLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR* |
| Ga0068868_1020076192 | 3300005338 | Miscanthus Rhizosphere | PPLPDPYSEPDRKGDLDMARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR* |
| Ga0070692_105615212 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRFLSKLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0070668_1011343661 | 3300005347 | Switchgrass Rhizosphere | GPPLPDPYSEPDRKGDLDMARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR* |
| Ga0070675_1004742252 | 3300005354 | Miscanthus Rhizosphere | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR* |
| Ga0070673_1006444012 | 3300005364 | Switchgrass Rhizosphere | MARRFLSKLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDPSER* |
| Ga0070688_1011226682 | 3300005365 | Switchgrass Rhizosphere | GDPEMARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0070659_1014000771 | 3300005366 | Corn Rhizosphere | ARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR* |
| Ga0070667_1014792282 | 3300005367 | Switchgrass Rhizosphere | LTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0070701_102381532 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR* |
| Ga0068867_1005216532 | 3300005459 | Miscanthus Rhizosphere | EMARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0070664_1023463011 | 3300005564 | Corn Rhizosphere | SEMARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0070664_1023913942 | 3300005564 | Corn Rhizosphere | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSP |
| Ga0068852_1024369542 | 3300005616 | Corn Rhizosphere | EMARRFLSKLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR* |
| Ga0082029_10716983 | 3300006169 | Termite Nest | MARRFLAKLTRTLTAEWTPDAGVHFHGGAHGRPYPCHDPRCTSPGLDVNER* |
| Ga0079222_102299222 | 3300006755 | Agricultural Soil | MARRLLSKLTRSLTSEWTPHAGVHFHGGAHGRPYPCHDPRCTSPGLDVSER* |
| Ga0079220_112535862 | 3300006806 | Agricultural Soil | MARRFLSKLTRTLTAEWTPTAGVHFHGGAHGRPYPCHDPRCTSPGLDVPGR* |
| Ga0075428_1023381192 | 3300006844 | Populus Rhizosphere | MARRFLSKLARNLTAEWTPGRGTHFHGGAHGRPYVCDDPQCVSPGLDPSKR* |
| Ga0075421_1021725472 | 3300006845 | Populus Rhizosphere | MARRFLSKLTRTLTAEWTPDSGVHFHGGAHGPYPCHDPRCTSP |
| Ga0075430_1010333382 | 3300006846 | Populus Rhizosphere | MARRFLAKLTRTLTAEWTPSSGVHFHGGAHGRPYPCHDPRCTSPGLDVAQH* |
| Ga0075434_1017862662 | 3300006871 | Populus Rhizosphere | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVSER* |
| Ga0079217_100850572 | 3300006876 | Agricultural Soil | MARRFLSKLTRTLTAEWTPNPGVHFHGGAHGRPYPCHDPRCTSPGLDVAGR* |
| Ga0079215_107476272 | 3300006894 | Agricultural Soil | MARRFLSKLTRALTAEWTPDSGVHFHGGADGRPYPCHDPRCTSPGLDVAER* |
| Ga0079216_118680582 | 3300006918 | Agricultural Soil | MARRFLSKLTRTLTAEWTPNPGVHFHGGAHGRPYPCHDPRCTSPGLDLSER* |
| Ga0079219_124933431 | 3300006954 | Agricultural Soil | MARRFLSKLTRSLTAEWTPHAGVHFHGGAHGRPYPCHDPRCTSPGLDVSER* |
| Ga0075418_116950992 | 3300009100 | Populus Rhizosphere | MARRFLSKLTRTLTAEWTPGRGTHFHGGAHGRPYVCDDPNCVSPGLEASKR* |
| Ga0075418_116968601 | 3300009100 | Populus Rhizosphere | MARRLISKLTRTLTAQWTPESGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR* |
| Ga0075418_122863931 | 3300009100 | Populus Rhizosphere | KGDLDMARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR* |
| Ga0105243_104464463 | 3300009148 | Miscanthus Rhizosphere | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDP |
| Ga0111538_114959461 | 3300009156 | Populus Rhizosphere | MARRFLSKLTRSLTAEWTPDAGVHFHGGAHGRPYPCHDPRCTSPGLDVSER* |
| Ga0111538_115735612 | 3300009156 | Populus Rhizosphere | MARRLISKLTRTLTAQWTPESGVHFHGGAHGRPYPCHDPRCT |
| Ga0126307_100364565 | 3300009789 | Serpentine Soil | MARRFLSKLTSTITAQWTPEAGVHFHGGAHGRPYVCDDPHCVSPSLDASRRS* |
| Ga0126307_100626401 | 3300009789 | Serpentine Soil | MARSFLSKLAGALTAEWAPAPGSGVHFHGGAHGRPYPCHDPYCTSPGLDTKQR* |
| Ga0126307_102593032 | 3300009789 | Serpentine Soil | MARRFLSKLTRSLTAEWTPDSGVHFHGGAHGPYPCHDPRCTSPGLDPSER* |
| Ga0126313_100113073 | 3300009840 | Serpentine Soil | MARRFLAKLTRSLTARWTPDHGVHFHGGAHGRPYPCHDPRCTSPGLDIGER* |
| Ga0126313_100116133 | 3300009840 | Serpentine Soil | MARRFLSKLTRSLTAEWTPDGVHFHGGAHGPYPCHDPRCTSPGLDVSER* |
| Ga0126313_104690772 | 3300009840 | Serpentine Soil | MARRFLAKLTRSLTAQWTPESGVHFHGGAHGRPYPCEDPRCTSPGLDISER* |
| Ga0126305_102079012 | 3300010036 | Serpentine Soil | MARSFLSKLAGALTAEWAPAPGSGVHFHGGAHGRPYPCHDPRCTSPGLDTKQR* |
| Ga0126305_106604351 | 3300010036 | Serpentine Soil | HHHQKGDPEMARRFLSKLTSTITAQWTPEAGVHFHGGAHGRPYVCDDPHCVSPSLDASRRS* |
| Ga0126304_106509802 | 3300010037 | Serpentine Soil | MARSFLSKLAGALTAEWAPAPGSGVHFHGGAHGRPYPCHDPRCTSPGLDTEQR* |
| Ga0126315_105824892 | 3300010038 | Serpentine Soil | MARRFLSKLTRSLTAEWTPDGVHFHGGAHGPYPCHDPRCTSPGLD |
| Ga0126309_102166391 | 3300010039 | Serpentine Soil | MARRFLSKLTRALTAEWTPDSGVHFHGGAHGPYPCHDPRCTSPGLDPSDR* |
| Ga0126309_102903292 | 3300010039 | Serpentine Soil | MARRFLSKLTRTITSQWVPDEGVHFHGGAHGRPYVCDDPHCVSPSLDPSRR* |
| Ga0126309_108578492 | 3300010039 | Serpentine Soil | QGFDLPDRKGDSEMARRFLSKLTRTLTAEWTPNPGVHFHGGAHGRPYPCHDPRCTSPGLDVSER* |
| Ga0126309_112003672 | 3300010039 | Serpentine Soil | MARRFLSKLSRSLTAEWAPTPGSGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR* |
| Ga0126308_100287274 | 3300010040 | Serpentine Soil | MARRFLAKLTRSLTAEWTPESGVHFHGGAHGRPYPCHDPRCTSPGLDISER* |
| Ga0126308_103089462 | 3300010040 | Serpentine Soil | MARRFLSKLTSTITAQWMPDEGVHFHGGAHGRPYVCDDPRCVSPSLDASRR* |
| Ga0126308_103594872 | 3300010040 | Serpentine Soil | MARRFLAKLTRSLTARWTPDHGVHFHGGAHGRPYPCHDP |
| Ga0126308_104450621 | 3300010040 | Serpentine Soil | PEMARRFLSKLTRSLTAEWTPDGVHFHGGAHGPYPCHDPRCTSPGLDVSER* |
| Ga0126314_106539151 | 3300010042 | Serpentine Soil | MARRFLAKLTRSLTARWTPDHGVHFHGGAHCRSYPCHDSRCTSP |
| Ga0126310_102694242 | 3300010044 | Serpentine Soil | MARSFLSKLAGTLTAEWAPAPGSGVHFHGGAHGRPYPCHDPRCTSPGLDAEHR* |
| Ga0126310_109718082 | 3300010044 | Serpentine Soil | MARRFLSKLTSTITAQWMPDEGVHFHGGAHGRPYVCDDPHCVSPSLDASRRS* |
| Ga0126311_100781073 | 3300010045 | Serpentine Soil | MARRFLSKLTSTITAQWTPEAGVHFHGGAHGRPYVCDDRHCVS |
| Ga0126311_116108961 | 3300010045 | Serpentine Soil | MARRFLAKLTRSLTAPWTPESGVHFHGGAHGRPYPCEDPRCTSPGLDIGER* |
| Ga0134125_113122472 | 3300010371 | Terrestrial Soil | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVAAR* |
| Ga0134127_105081692 | 3300010399 | Terrestrial Soil | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0134127_108122871 | 3300010399 | Terrestrial Soil | MARRFLSKLTRSLTAEWTPNAGVHFHGGAHGRPYPCHDPRCPSPGLDVGER* |
| Ga0134123_115264962 | 3300010403 | Terrestrial Soil | MARRFLSKLTRSLTAEWTPNAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER* |
| Ga0150985_1085138301 | 3300012212 | Avena Fatua Rhizosphere | MARRFLSKLTSTITAQWVPDEGVHFHGGAHGRPYVCDDPHCVSPSLDASQG* |
| Ga0157374_124303081 | 3300013296 | Miscanthus Rhizosphere | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDPSER* |
| Ga0157377_102697232 | 3300014745 | Miscanthus Rhizosphere | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRWTSPGLDVRER* |
| Ga0190265_105538792 | 3300018422 | Soil | MARRFLSKLTRSLTAQWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTGR |
| Ga0190265_110238032 | 3300018422 | Soil | MARRFLSKLTRTLTAEWTPNPGVHFHGGAHGRPYPCHDPRCTS |
| Ga0190265_134799622 | 3300018422 | Soil | MARRFLSKLTRTLTAEWTPGSGVHFHGGAHGRPYPCHDPRCTSPGLDVPAR |
| Ga0190272_113825351 | 3300018429 | Soil | MARRFLSKLTRTLTAEWVPAPGTGVHFHGGAHGRPYPCHDPRCTSPGLDVTGN |
| Ga0190275_101136373 | 3300018432 | Soil | MARRFLSKLTRTLTAEWTPNPGVHFHGGAHGRPYPCHDPRCTSPGLDVAER |
| Ga0190275_125746312 | 3300018432 | Soil | MARRFVSKLTRVLTSQWTEPGVHFHGGAHGRPYPCHDPRCTSPGLDVEPRRP |
| Ga0190268_115472172 | 3300018466 | Soil | MARRFLARLTRSLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVAER |
| Ga0190270_100724372 | 3300018469 | Soil | MARRFLSKLTSTLTAEWAPAPGSGTHFHGGAHGRPYPCHDPRCTSPGLDVSER |
| Ga0190270_110514532 | 3300018469 | Soil | MARRLISKLTRTLTAEWTPNAGVHFHGGAHGRPYPCHDPRCTSPGLDVTER |
| Ga0190270_134571761 | 3300018469 | Soil | MARRFLSKLTRSLTAEWAPTPGAGVHFHGGAHGRPYPCHDPRCISPGLD |
| Ga0190274_109451802 | 3300018476 | Soil | SKLTRSLTAEWTPSGVHFHGGAHGPYPCHDPRCTSPGLDISER |
| Ga0190274_122762012 | 3300018476 | Soil | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTER |
| Ga0173481_101662662 | 3300019356 | Soil | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR |
| Ga0190264_103772332 | 3300019377 | Soil | MARRFLSKLTRTLTAQWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVSKN |
| Ga0206356_112796031 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | EMARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER |
| Ga0206352_103070541 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRFLSKLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER |
| Ga0206353_105277671 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRFLSKLTRSLTAEWTPEAGVHFHGGAHGRPYPCHDPRCTSPGLDVRER |
| Ga0196958_100034283 | 3300020181 | Soil | MARRFLSKLTRTLTAQWTPESGVHFHGGAHGRPYPCHDRRCTSPALDVEQR |
| Ga0196959_101598042 | 3300021184 | Soil | MARRFLSKLTRTLTAQWTPESGVHFHGGAHGRPYPCHDRRCTSPALDV |
| Ga0207644_110842922 | 3300025931 | Switchgrass Rhizosphere | MARRFLSKLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR |
| Ga0207690_111570582 | 3300025932 | Corn Rhizosphere | RTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR |
| Ga0207709_106660311 | 3300025935 | Miscanthus Rhizosphere | HSAPDRKGDLDMARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR |
| Ga0207709_113416092 | 3300025935 | Miscanthus Rhizosphere | MARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPC |
| Ga0207679_111035781 | 3300025945 | Corn Rhizosphere | KLTRTLTAEWTPSAGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR |
| Ga0207712_111134771 | 3300025961 | Switchgrass Rhizosphere | MARRLISKLTRTLTAEWTPDSDVHFHGGAHGRPYPCHDPRCTSPGLDVTQR |
| Ga0207668_109225172 | 3300025972 | Switchgrass Rhizosphere | PYSEPDRKGDLDMARRLISKLTRTLTAEWTPDSGVHFHGGAHGRPYPCHDPRCTSPGLDVTQR |
| Ga0207677_111156932 | 3300026023 | Miscanthus Rhizosphere | MARRFLSKLTRTLTAEWTPGAGVHFHGGAHGRPYPCHDPRCTSPGLDVSGR |
| Ga0209382_117018082 | 3300027909 | Populus Rhizosphere | MARRFLSKLTRTLTAEWTPDSGVHFHGGAHGPYPCHDPRCTSPGLDIS |
| Ga0247818_113911742 | 3300028589 | Soil | MARRFLSKLTRTLTAEWTPGRGTHFHGGAHGRPYVCDDPNCVSPGLEASKR |
| Ga0307319_101723552 | 3300028722 | Soil | MARRFLSKLTRSLTAEWAPTPGAGVHFHGGAHGRPYPCHDPRCTSPGLDPSER |
| Ga0247825_107293152 | 3300028812 | Soil | MARRFLSKLTRTLTAEWTPGRGTHFHGGAHGRPYVCDDPHCVSPGLDASRR |
| Ga0247826_102748261 | 3300030336 | Soil | DHHERRPEMARRFLSKLTRTLTAEWTPGRGTHFHGGAHGRPYVCDDPNCVSPGLEASKR |
| Ga0247826_103280632 | 3300030336 | Soil | MARRFLSKLTRTLTAEWTPGRGTHFHGGAHGRPYVCDDPHCVSP |
| Ga0247826_115365521 | 3300030336 | Soil | MARRFLSKLTRTLTAEWTPGRGTHFHGGAHGRPYVCDDPNCVSPGLDASKR |
| Ga0299913_105150952 | 3300031229 | Soil | MARRFLSALTRNLTAEWTPGRGTHFHGGAHGRPYVCDDPRCVSPGFDASQG |
| Ga0307413_116595421 | 3300031824 | Rhizosphere | MARRFLSKLTRALTAEWTPNSDVHFHGGAHGRPYPCHDPRCTSPGLDVSAR |
| Ga0307410_107891122 | 3300031852 | Rhizosphere | MARRFLSKLTRTLTAEWTPDSGVHFHGGAHGPYPCHDPRCTSPGLDVSER |
| Ga0307406_105902032 | 3300031901 | Rhizosphere | MARRFLSKLTRTLTAEWTPDTGVHFHGGAHGRPYPCHDPRCTSPGLDISER |
| Ga0307406_118312721 | 3300031901 | Rhizosphere | KGDSEMARRFLSKLTRSLTAEWAPNAGVHFHGGAHGRPYPCHDPRCTSPGLDVSAR |
| Ga0307412_114545162 | 3300031911 | Rhizosphere | MARRFLAKLTRSLTAEWTPESGVHFHGGAHGRPYPCHDPRCTSPGLDISER |
| Ga0307412_120646071 | 3300031911 | Rhizosphere | RLYARCMQASDPDRKGDSEMARRFLSKLTRTLTAEWTPGSGVHFHGGAHGRPYPCHDPRCTSPGLDVSER |
| Ga0307409_1026932012 | 3300031995 | Rhizosphere | MARRFLSKLTRSLTAEWTPDGVHFHGGAHGPYPCHDPRCTSPGLDVSER |
| Ga0307411_112983211 | 3300032005 | Rhizosphere | MARRFLSKLTRSLTSEWTPNAGVHFHGGAHGRPYPCHDPRCTSPGLDVGER |
| Ga0326721_100897081 | 3300032080 | Soil | TRSLTAEWTPDSGVHFHGGAHGPYPCHDPRCTSPGLDVDER |
| Ga0307415_1006431221 | 3300032126 | Rhizosphere | SKLTRTLTAEWTPASGVHFHGGAHGRPYPCHDPRCTSPGLDVSAR |
| Ga0307415_1024365981 | 3300032126 | Rhizosphere | RFLSKLTRTLTAEWTPNAGVHFHGGAHGPYPCHDPRCTSPGLDLSER |
| Ga0314788_137283_1_129 | 3300034666 | Soil | TRTLTAEWTPGRGTHFHGGAHGRPYVCDDPNCVSPGLEASKS |
| ⦗Top⦘ |