| Basic Information | |
|---|---|
| Family ID | F087726 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPRAVIVLLVLVLVLVGLMFFFSSQADEVPTNTIEVEVNAPANAN |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.82 % |
| % of genes near scaffold ends (potentially truncated) | 34.55 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.818 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (33.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01202 | SKI | 51.82 |
| PF02254 | TrkA_N | 2.73 |
| PF01406 | tRNA-synt_1e | 1.82 |
| PF13541 | ChlI | 0.91 |
| PF02899 | Phage_int_SAM_1 | 0.91 |
| PF01476 | LysM | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.91 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.82 % |
| Unclassified | root | N/A | 8.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_F5JHDJD02G74FK | Not Available | 521 | Open in IMG/M |
| 3300002076|JGI24749J21850_1084190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 502 | Open in IMG/M |
| 3300003312|P12013IDBA_1003297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 9898 | Open in IMG/M |
| 3300003312|P12013IDBA_1012586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3827 | Open in IMG/M |
| 3300003312|P12013IDBA_1022264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2299 | Open in IMG/M |
| 3300004114|Ga0062593_101755877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300004156|Ga0062589_101843611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 608 | Open in IMG/M |
| 3300004479|Ga0062595_100011366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2955 | Open in IMG/M |
| 3300005093|Ga0062594_100650519 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005328|Ga0070676_11311765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 553 | Open in IMG/M |
| 3300005333|Ga0070677_10120581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1184 | Open in IMG/M |
| 3300005353|Ga0070669_100113676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2057 | Open in IMG/M |
| 3300005353|Ga0070669_100197268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1582 | Open in IMG/M |
| 3300005354|Ga0070675_100742962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 895 | Open in IMG/M |
| 3300005355|Ga0070671_100253886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1494 | Open in IMG/M |
| 3300005457|Ga0070662_100762583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 821 | Open in IMG/M |
| 3300005548|Ga0070665_102561605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 511 | Open in IMG/M |
| 3300005719|Ga0068861_102064596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 569 | Open in IMG/M |
| 3300005985|Ga0081539_10079155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1733 | Open in IMG/M |
| 3300006169|Ga0082029_1189868 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006169|Ga0082029_1419503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 12572 | Open in IMG/M |
| 3300006865|Ga0073934_10279394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1079 | Open in IMG/M |
| 3300007004|Ga0079218_10976910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 844 | Open in IMG/M |
| 3300009094|Ga0111539_13030908 | Not Available | 543 | Open in IMG/M |
| 3300009789|Ga0126307_10424514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1072 | Open in IMG/M |
| 3300009789|Ga0126307_10473289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1011 | Open in IMG/M |
| 3300010045|Ga0126311_10565957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
| 3300012900|Ga0157292_10341296 | Not Available | 550 | Open in IMG/M |
| 3300012943|Ga0164241_10829095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 674 | Open in IMG/M |
| 3300012951|Ga0164300_11010628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 536 | Open in IMG/M |
| 3300015371|Ga0132258_10054999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9135 | Open in IMG/M |
| 3300015371|Ga0132258_10104877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 6674 | Open in IMG/M |
| 3300015371|Ga0132258_12019377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1450 | Open in IMG/M |
| 3300015372|Ga0132256_100495341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1332 | Open in IMG/M |
| 3300018432|Ga0190275_13072958 | Not Available | 540 | Open in IMG/M |
| 3300018465|Ga0190269_10860482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 663 | Open in IMG/M |
| 3300018465|Ga0190269_11265192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 586 | Open in IMG/M |
| 3300018466|Ga0190268_10140104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1213 | Open in IMG/M |
| 3300018466|Ga0190268_10143873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1204 | Open in IMG/M |
| 3300018476|Ga0190274_12145999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 655 | Open in IMG/M |
| 3300018481|Ga0190271_10004573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 8948 | Open in IMG/M |
| 3300018481|Ga0190271_12864741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 579 | Open in IMG/M |
| 3300019377|Ga0190264_10311152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 961 | Open in IMG/M |
| 3300020202|Ga0196964_10391495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300022756|Ga0222622_10830350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 676 | Open in IMG/M |
| 3300025903|Ga0207680_11051311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 583 | Open in IMG/M |
| 3300025907|Ga0207645_10632311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 727 | Open in IMG/M |
| 3300025907|Ga0207645_11015482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 561 | Open in IMG/M |
| 3300025923|Ga0207681_10102483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2067 | Open in IMG/M |
| 3300025923|Ga0207681_10896906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 742 | Open in IMG/M |
| 3300025926|Ga0207659_10658645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 895 | Open in IMG/M |
| 3300025930|Ga0207701_11093163 | Not Available | 661 | Open in IMG/M |
| 3300025931|Ga0207644_10251906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1409 | Open in IMG/M |
| 3300025931|Ga0207644_11028256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 692 | Open in IMG/M |
| 3300025933|Ga0207706_11182510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 636 | Open in IMG/M |
| 3300025940|Ga0207691_10922343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300025941|Ga0207711_11505392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 616 | Open in IMG/M |
| 3300025945|Ga0207679_10180610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 1745 | Open in IMG/M |
| 3300025972|Ga0207668_11428872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 624 | Open in IMG/M |
| 3300027614|Ga0209970_1040001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300027886|Ga0209486_11074335 | Not Available | 545 | Open in IMG/M |
| 3300028379|Ga0268266_12040707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 547 | Open in IMG/M |
| 3300028587|Ga0247828_11099861 | Not Available | 526 | Open in IMG/M |
| 3300028590|Ga0247823_10221774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1434 | Open in IMG/M |
| 3300028889|Ga0247827_10515834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 750 | Open in IMG/M |
| 3300031538|Ga0310888_11110824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 500 | Open in IMG/M |
| 3300031548|Ga0307408_100011886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5759 | Open in IMG/M |
| 3300031548|Ga0307408_100161672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1779 | Open in IMG/M |
| 3300031548|Ga0307408_100814755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300031548|Ga0307408_101262679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 691 | Open in IMG/M |
| 3300031548|Ga0307408_101390241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 660 | Open in IMG/M |
| 3300031548|Ga0307408_101491308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 639 | Open in IMG/M |
| 3300031731|Ga0307405_10055811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2474 | Open in IMG/M |
| 3300031731|Ga0307405_10067038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2291 | Open in IMG/M |
| 3300031731|Ga0307405_10502228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 972 | Open in IMG/M |
| 3300031731|Ga0307405_10764215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 806 | Open in IMG/M |
| 3300031731|Ga0307405_10791828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300031731|Ga0307405_11347747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 622 | Open in IMG/M |
| 3300031731|Ga0307405_11412627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 609 | Open in IMG/M |
| 3300031731|Ga0307405_12097506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 507 | Open in IMG/M |
| 3300031824|Ga0307413_10131632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1713 | Open in IMG/M |
| 3300031824|Ga0307413_10156155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1596 | Open in IMG/M |
| 3300031824|Ga0307413_10265396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 1282 | Open in IMG/M |
| 3300031824|Ga0307413_10784836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 799 | Open in IMG/M |
| 3300031824|Ga0307413_11010956 | Not Available | 713 | Open in IMG/M |
| 3300031824|Ga0307413_11134179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 677 | Open in IMG/M |
| 3300031824|Ga0307413_11826415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 544 | Open in IMG/M |
| 3300031852|Ga0307410_10010782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5198 | Open in IMG/M |
| 3300031852|Ga0307410_10129717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1851 | Open in IMG/M |
| 3300031852|Ga0307410_10186324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1575 | Open in IMG/M |
| 3300031852|Ga0307410_11761256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 550 | Open in IMG/M |
| 3300031854|Ga0310904_10284914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1040 | Open in IMG/M |
| 3300031901|Ga0307406_10795401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 798 | Open in IMG/M |
| 3300031903|Ga0307407_10545153 | Not Available | 856 | Open in IMG/M |
| 3300031903|Ga0307407_10920661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300031995|Ga0307409_100135658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2111 | Open in IMG/M |
| 3300031995|Ga0307409_100629230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1064 | Open in IMG/M |
| 3300031995|Ga0307409_101733188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 653 | Open in IMG/M |
| 3300032000|Ga0310903_10593608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 589 | Open in IMG/M |
| 3300032004|Ga0307414_11312153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 672 | Open in IMG/M |
| 3300032004|Ga0307414_11431773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 642 | Open in IMG/M |
| 3300032005|Ga0307411_10149293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1735 | Open in IMG/M |
| 3300032005|Ga0307411_10651863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 912 | Open in IMG/M |
| 3300032005|Ga0307411_11292384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 664 | Open in IMG/M |
| 3300032012|Ga0310902_10427882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 849 | Open in IMG/M |
| 3300032013|Ga0310906_11379577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 517 | Open in IMG/M |
| 3300032075|Ga0310890_10833754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 732 | Open in IMG/M |
| 3300032126|Ga0307415_100733410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 895 | Open in IMG/M |
| 3300032179|Ga0310889_10112873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1174 | Open in IMG/M |
| 3300033412|Ga0310810_10685971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 33.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.64% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.73% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil | 2.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.73% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
| 3300003312 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_03772450 | 2070309009 | Soil | MPRGFIVLILLVLVIAGLLWFFSSQADEVPTNTIEV |
| JGI24749J21850_10841902 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRAVVFLILILLVIVGLMFFFSSRAGEVPTHSIETQVN |
| P12013IDBA_10032973 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MPRAILVLVVLVLAVLALLWFLSRSAGEVPTRTIEVGVNAPADAR* |
| P12013IDBA_10125863 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MPRAAILIFFVLLVVLGLLWFLSSQAEEVPTRTIEVEVNAPANAG* |
| P12013IDBA_10222642 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MPRAILILLLLVLAVAGLLWFLSGSAREVPTRTIEAEVDAPADAR* |
| Ga0062593_1017558772 | 3300004114 | Soil | MPRAVIVLLVLVLLVVGLMFFFSSRAGEVPTKTIETEVTAPANAS* |
| Ga0062589_1018436111 | 3300004156 | Soil | MPRAVILLILVVLVLLGLLFFFSHHASEQPTRTMEAEVNQPANAQ* |
| Ga0062595_1000113662 | 3300004479 | Soil | MPRAVVFLILILLVIVGLMFFFSSRAGEVPTHSIETQVNAPANAS* |
| Ga0062594_1006505192 | 3300005093 | Soil | MPRAVIVLVVLLLLIIGLMFFFSRQAGEVPTKTIETEVTATSNAS* |
| Ga0070676_113117651 | 3300005328 | Miscanthus Rhizosphere | MPRAVILLIVVLLLVVGLLFFFSSRANEVPTRAIEVEVNAPANAS* |
| Ga0070677_101205813 | 3300005333 | Miscanthus Rhizosphere | MPRAVILLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQPAN |
| Ga0070669_1001136762 | 3300005353 | Switchgrass Rhizosphere | MPRAVIVLLVLVLLVVGLMFFFSSRAGEQPTKTIEVEVNQPANAS* |
| Ga0070669_1001972681 | 3300005353 | Switchgrass Rhizosphere | TMPRAVILLIVVLLLVVGLLFFFSSRANEVPTRAIEVEVNAPANAS* |
| Ga0070675_1007429621 | 3300005354 | Miscanthus Rhizosphere | VPIPKDASAMPRAVIVLVVLLLLIIGLMFFFSRQAGEVPTKTIETEVTATSNAS* |
| Ga0070671_1002538863 | 3300005355 | Switchgrass Rhizosphere | MPRAVILLILVVLVLLGLMFFFSHHAGEKPTRTIEVEVNQPANAQ* |
| Ga0070662_1007625832 | 3300005457 | Corn Rhizosphere | MPRAVILLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQPANAQ* |
| Ga0070665_1025616051 | 3300005548 | Switchgrass Rhizosphere | MPRAIIVLLLIVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN* |
| Ga0068861_1020645961 | 3300005719 | Switchgrass Rhizosphere | RAVVFLILILLVIVGLMFFFSSRAGEVPTHSIETQVNAPANAS* |
| Ga0081539_100791552 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MPRAVLVLIALLVLVAALLAFLSTRAREVPTNTIEVEVNAPANAR* |
| Ga0082029_11898681 | 3300006169 | Termite Nest | MPRAVIVLLLLVLVIAGLMWFFSSQADEVPTNRIEVEVNAPANAS* |
| Ga0082029_14195039 | 3300006169 | Termite Nest | MPRAVIVLLVLFVLIVGLLWFFSSRATDVPAHTIEVEVNAPANAR* |
| Ga0073934_102793942 | 3300006865 | Hot Spring Sediment | MPRAVIFLLVLVLLVVGLMFFFSSQADEVPTNTIEVEVNAPANAN* |
| Ga0079218_109769102 | 3300007004 | Agricultural Soil | MPRAVIVLLVLVLLIVGLMFFFSSRAVEVQPSTIEVEVNAPANAN* |
| Ga0111539_130309082 | 3300009094 | Populus Rhizosphere | MPRAVILLILVVIVLLGLLFFFSHHAGEEPTRTIEVEVNQPANAQ* |
| Ga0126307_104245142 | 3300009789 | Serpentine Soil | LVLVLLIVGLMFFFSSRAEEVQPSTIEVEVNAPANAN* |
| Ga0126307_104732891 | 3300009789 | Serpentine Soil | MPRAVIVLLVLVLLIVGLMFFFSSRAEEVQPSTIEVEVNAPANAN* |
| Ga0126311_105659573 | 3300010045 | Serpentine Soil | MPRALIVLLVLVLLIVGLMFFFSSRAEEVQPSTIEVEVNAPANAN* |
| Ga0157292_103412962 | 3300012900 | Soil | VLVLLGLLFFFSHHASEQPTRTMEAEVNQPANAQ* |
| Ga0164241_108290952 | 3300012943 | Soil | MPRAVILLILVVLVLVGLMFFFSRQADEVPTRTIEVEVNQPANAQ* |
| Ga0164300_110106281 | 3300012951 | Soil | QTRVKMPRAVIVLLVLVLLVAGLMFFFSSRAGEVPTKTIETEVTAPANAS* |
| Ga0132258_100549999 | 3300015371 | Arabidopsis Rhizosphere | MPRAIILLIVVLLLFVGLLFFFSSRANEVPTRAIEVEVNAPANAS* |
| Ga0132258_101048775 | 3300015371 | Arabidopsis Rhizosphere | MPRAVVFLILILLVIVGLMFFFSSRAGEVPTHSIETQVNAPGNAS* |
| Ga0132258_120193772 | 3300015371 | Arabidopsis Rhizosphere | MPRAVIILLVLVLVLVGLMFFFSSQAEEVQPSTIEVEVNAPANAN* |
| Ga0132256_1004953412 | 3300015372 | Arabidopsis Rhizosphere | MPRAVILLILVVLVLLGLMFFFSHHAGEKPTRAIEVEVNQPANAQ* |
| Ga0190275_130729581 | 3300018432 | Soil | MPRGFIVLLLLLLVILGLIWFFSSQADEVPTNTIEV |
| Ga0190269_108604822 | 3300018465 | Soil | MPRAVIFLLVLVLLLVGLMFFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0190269_112651922 | 3300018465 | Soil | LVLVIAGLLWFFSSQADEVPTNTIEVKVHAPANAN |
| Ga0190268_101401042 | 3300018466 | Soil | MPRGFIVLLLLLLVILGLMWFFSSQADEVPTNTIEVEVIAPANAN |
| Ga0190268_101438733 | 3300018466 | Soil | MPRGFIVLILLVLVIAGLMWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0190274_121459992 | 3300018476 | Soil | MPRAVIVLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQPANAQ |
| Ga0190271_100045738 | 3300018481 | Soil | MPRAVIVLLVLVLLLVGLMFFFSSQADEVPTSTMEVEVNAPANAN |
| Ga0190271_128647412 | 3300018481 | Soil | MPRGFIVLLLLLLVILGLMWFFSSQADEVPTNMIEVEVNAPANAN |
| Ga0190264_103111521 | 3300019377 | Soil | MPRGFIVLILLVLVIAGLLWFLSSQADEVPTNTIEVEV |
| Ga0196964_103914952 | 3300020202 | Soil | MPRAVLFLTLLLILIVGLLWFFSSQAEEVPTRTIEIEVNSSANAS |
| Ga0222622_108303502 | 3300022756 | Groundwater Sediment | MPRAVILLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQPANAQ |
| Ga0207680_110513112 | 3300025903 | Switchgrass Rhizosphere | MPRAVVFLILILLVIVGLMFFFSSRAGEVPTHSIETQVNAPANAS |
| Ga0207645_106323112 | 3300025907 | Miscanthus Rhizosphere | MPRAVILLIVVLLLVVGLLFFFSSRANEVPTRAIEVEVNAPANAS |
| Ga0207645_110154821 | 3300025907 | Miscanthus Rhizosphere | AVVFLILILLVIVGLMFFFSSRAGEVPTHSIETQVNAPANAS |
| Ga0207681_101024832 | 3300025923 | Switchgrass Rhizosphere | MPRAVIVLLVLVLLVVGLMFFFSSRAGEQPTKTIEVEVNQPANAS |
| Ga0207681_108969061 | 3300025923 | Switchgrass Rhizosphere | RAVIILLVLVLVLVGLMFFFSSQAEEVQPSTIEVEVNAPANAN |
| Ga0207659_106586452 | 3300025926 | Miscanthus Rhizosphere | VPIPKDASAMPRAVIVLVVLLLLIIGLMFFFSRQAGEVPTKTIETEVTATSNAS |
| Ga0207701_110931632 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRAVILLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQPANAQ |
| Ga0207644_102519062 | 3300025931 | Switchgrass Rhizosphere | MPRAVILLILVVLVLLGLMFFFSHHAGEKPTRTIEVEVNQPANAQ |
| Ga0207644_110282562 | 3300025931 | Switchgrass Rhizosphere | MPRALIVLLVILLVIAGLMFFFSSRAGEVPTRTIETEVNAPANAS |
| Ga0207706_111825101 | 3300025933 | Corn Rhizosphere | VLLLLIIGLMFFFSRQAGEVPTKTIETEVTATSNAS |
| Ga0207691_109223432 | 3300025940 | Miscanthus Rhizosphere | MPRAVILLILVVLVLLGLLFFFSHHASEQPTRTMEAEVNQPANAQ |
| Ga0207711_115053921 | 3300025941 | Switchgrass Rhizosphere | MPRAVIVLVVLLLLIIGLMFFFSRQAGEVPTKTIETEVTATSNAS |
| Ga0207679_101806102 | 3300025945 | Corn Rhizosphere | RPKQTRVKMPRAVIVLLVLVLLVVGLMFFFSSRAGEVPTKTIETEVTAPANAS |
| Ga0207668_114288722 | 3300025972 | Switchgrass Rhizosphere | LLLIVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0209970_10400012 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MPRAVIVLLVLVLLVVGLMFFFSSRAGEVPTKTIETEVTAPANAS |
| Ga0209486_110743352 | 3300027886 | Agricultural Soil | MPRAVIVLLVLVLLIVGLMFFFSSRAVEVQPSTIEVEVNAPANAN |
| Ga0268266_120407071 | 3300028379 | Switchgrass Rhizosphere | MPRAIIVLLLIVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0247828_110998612 | 3300028587 | Soil | PVSHLPNSMRVPMPRAVIVLIVLLILIVGLLWFFSSRATDVPARTIEVEVNAPANAR |
| Ga0247823_102217742 | 3300028590 | Soil | MPRAVIVLIVLLILIVGLLWFFSSRATDVPARTIEVEVNAPANAR |
| Ga0247827_105158342 | 3300028889 | Soil | MPRAVIVLLVLVLLVAGLMFFFSSRAGEVPTKTIETEVTAPANAS |
| Ga0310888_111108242 | 3300031538 | Soil | MPRAVIVLLVLVLLVAGLMFFFSSRAGEVPTKTIETEVTAP |
| Ga0307408_1000118863 | 3300031548 | Rhizosphere | MPRAVIVLIVLLALIVGLLWFFSSRANDVPARTIEVEVNAPANAR |
| Ga0307408_1001616723 | 3300031548 | Rhizosphere | MPRGFIVLILLVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307408_1008147551 | 3300031548 | Rhizosphere | MPRAVIVLLVLVLILAGLMFFFSRQAGEVPTKTIETEVTAPAN |
| Ga0307408_1012626792 | 3300031548 | Rhizosphere | MPRAVIVLLVLVLLLVGLMFFFSSRAGEVPTKTIETEVTAPANAS |
| Ga0307408_1013902411 | 3300031548 | Rhizosphere | VLLIIVVLLIVGLLFFFSSRADEVPTRTIEVEVNAPANAS |
| Ga0307408_1014913081 | 3300031548 | Rhizosphere | IVLILLVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307405_100558111 | 3300031731 | Rhizosphere | THRRRVPMPRGFIVLILLVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307405_100670381 | 3300031731 | Rhizosphere | MPRGFIVLILLVLVIAGLLWFFSSQADEVPTNTIEVE |
| Ga0307405_105022282 | 3300031731 | Rhizosphere | MPRAVIVLLVLVLLIVGLMFFFSSRAEEVQPSTIEVEVNAPANAN |
| Ga0307405_107642152 | 3300031731 | Rhizosphere | MPRAVIVLLVLVLLIVGLTFFFSSRAEEVQPSTIEVEVNAPANAN |
| Ga0307405_107918281 | 3300031731 | Rhizosphere | MPRAVIVLLVLVLILAGLMFFFSRQAGEVPTKTIETEVTAPANAS |
| Ga0307405_113477471 | 3300031731 | Rhizosphere | VIVLLLLLLVMLGLMWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307405_114126272 | 3300031731 | Rhizosphere | MPRAIIVLLLIVMVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307405_120975061 | 3300031731 | Rhizosphere | MPRAVIVLILVILAIAGLMIFFSSRADEVPTRTIEVEVNTTANAS |
| Ga0307413_101316322 | 3300031824 | Rhizosphere | MPRAVIVLLLLVLVLGGLTWFFSSQADEVPTNIVEVEVNTPANAN |
| Ga0307413_101561551 | 3300031824 | Rhizosphere | RAAKARVPSANSMRVTMPRAVIVLIVLLALIVGLLWFFSSRANDVPARTIEVEVNAPANA |
| Ga0307413_102653962 | 3300031824 | Rhizosphere | VIVLLVLVLLVVGLMFFFSSRAGEVPTKTIETEVTAPANAS |
| Ga0307413_107848362 | 3300031824 | Rhizosphere | MPRAVIVLLVLILVLVGLMFFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307413_110109562 | 3300031824 | Rhizosphere | MPRGFIVLILIVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307413_111341792 | 3300031824 | Rhizosphere | MSRGLTLLILLVIVIAGLLWFLAGSADEVPTRTIEVDVNAPANAN |
| Ga0307413_118264152 | 3300031824 | Rhizosphere | MPRALILLILLLLVVVGLLFFFSSQAEEVPVQPIEIEVNTPADAR |
| Ga0307410_100107825 | 3300031852 | Rhizosphere | MPRAVIVLIFLLILIVGLLWFFSSRATDVPARTIEVEVNAPANAR |
| Ga0307410_101297173 | 3300031852 | Rhizosphere | MPRAVIVLIVLLVLIVGLLWFFSSRATDVPARTIEVEVNAPANAR |
| Ga0307410_101863242 | 3300031852 | Rhizosphere | MPRAVIVLLVLVLVLVGLMFFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307410_117612562 | 3300031852 | Rhizosphere | MPRAVILLILVVLVLLGLIFFFSHNAGEEPTRTIEVEVNQPANAQ |
| Ga0310904_102849143 | 3300031854 | Soil | MPRAVILLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQLANAQ |
| Ga0307406_107954012 | 3300031901 | Rhizosphere | MPRGFIVLLLLLLVILGLMWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0307407_105451532 | 3300031903 | Rhizosphere | MRVTMPRAVIVLIVLLVLIVGLLWFFSSRATDVPARTIEVEVNAPANAR |
| Ga0307407_109206612 | 3300031903 | Rhizosphere | MPRAVIVLLVLVLLVVGLMFFFSSRAGEVSTKTIETEVTAPANAS |
| Ga0307409_1001356582 | 3300031995 | Rhizosphere | MPRAVIFLIVFVLLVVGLLWFLSGRASEVPTNTIEVEVNAPANAR |
| Ga0307409_1006292301 | 3300031995 | Rhizosphere | LVLALGGLTWFFSSQADEVPTNIVEVEVNTPANAN |
| Ga0307409_1017331881 | 3300031995 | Rhizosphere | LIIVVLLIVGLLFFFSSRADEVPTRTIEVEVNAPANAS |
| Ga0310903_105936082 | 3300032000 | Soil | RAVIVLLVLVLLVVGLMFFFSSRAGEVPTKTIETEVTAPANAS |
| Ga0307414_113121531 | 3300032004 | Rhizosphere | MPRAVIVLLVLVLLLVGLMFFFSSRAGEVPTKTIETDVTAPANAS |
| Ga0307414_114317731 | 3300032004 | Rhizosphere | QKRSHSRPKQTRVKMPRAVIVLLVLVLILAGLMFFFSRQAGEVPTKTIETEVTAPANAS |
| Ga0307411_101492932 | 3300032005 | Rhizosphere | MPRAVIVLLVLVLVLVGLMFFFSSQADEVPTSTVEVEVNAPANAN |
| Ga0307411_106518631 | 3300032005 | Rhizosphere | FATRVKMPRAVIVFLVLVLLIVGLMFFFSSRAEEVQPSTIEVEVNAPAHAN |
| Ga0307411_112923841 | 3300032005 | Rhizosphere | FIVLILLVLVIAGLLWFFSSQADEVPTNTIEVEVNAPANAN |
| Ga0310902_104278821 | 3300032012 | Soil | MPRALLVLLVILLVIAGLMFFFSSRAGEVPTRPIETEVNAPANAS |
| Ga0310906_113795771 | 3300032013 | Soil | VILLILVVLVLLGLLFFFSHHAGEEPTRTIEVEVNQLANAQ |
| Ga0310890_108337542 | 3300032075 | Soil | MPRALLVLLVILLVIAGLMFFFSSRAVEVPTRPIETEVNAPANAS |
| Ga0307415_1007334102 | 3300032126 | Rhizosphere | RAPMPRGFIVLLLIILVIAGLLWFFSSQADEVPTNTIEVEVNAQANAN |
| Ga0310889_101128732 | 3300032179 | Soil | TDASTMPRALLVLLVILLVIAGLMFFFSSRAGEVPTRPIETEVNAPANAS |
| Ga0310810_106859711 | 3300033412 | Soil | MPRAVIALIVILLVIVGLFFLLSRQAGEVPTKTIEVEVNQPANAH |
| ⦗Top⦘ |