| Basic Information | |
|---|---|
| Family ID | F087700 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LAIGFAAVNPKKLKGAKSFTIAFSVWAAYVVCRVGWAFIFS |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.636 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01702 | TGT | 50.00 |
| PF07549 | Sec_GG | 4.55 |
| PF02699 | YajC | 2.73 |
| PF13620 | CarboxypepD_reg | 0.91 |
| PF00005 | ABC_tran | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 50.00 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 50.00 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 4.55 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 4.55 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 2.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.64 % |
| All Organisms | root | All Organisms | 36.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102070362 | 3300000567 | Peatlands Soil | CKNVDVFVIWYLLLIAIGFAGTNPKKLKGGKSFTIAFSVMAVYLVLRVGIAFIFS* |
| JGI12053J15887_103365762 | 3300001661 | Forest Soil | DIFTFWTLILLAIGFAAVNPKKLKGSKTYTIAFGVWAAFVACRVGWAFIFS* |
| JGI25381J37097_10433741 | 3300002557 | Grasslands Soil | IGFAAVSPKKLKGSKTYTIAFGVWAAFVVLRVCWAFIFS* |
| JGI25384J37096_102145471 | 3300002561 | Grasslands Soil | AIGFAAVNPKKLKGAKSFTIAFTVWAVYVVCRVGWAFIFS* |
| JGI25389J43894_10456792 | 3300002916 | Grasslands Soil | ILLAIGFAAVNPKKLKGAKSFTIAFSVWVVYVVCRVGWAFIFS* |
| Ga0062385_100294664 | 3300004080 | Bog Forest Soil | FTIWTLILVAIGFAAVNPKKLKGGAAYAIVFGVYGAYVVVRVIWAFAFS* |
| Ga0062385_109582031 | 3300004080 | Bog Forest Soil | LCKSIDVFSIWTMILLAIGFAATSPKKLKGSKPYMIVFGLWAAFVVCRVGWAFIFS* |
| Ga0066395_110378941 | 3300004633 | Tropical Forest Soil | LLAIGFAAVNPKRLKGAKPFTIAFTVWAVFTAIRVGGALIFS* |
| Ga0062388_1012203892 | 3300004635 | Bog Forest Soil | IGFAATSPKKLKGSKAYMIVFGLWVAFVICRVGWAFAFS* |
| Ga0062388_1023525032 | 3300004635 | Bog Forest Soil | WTLILIAIGFAATSPKKLKGAKPYIVAFGVWAAYVVARVGFAFAFS* |
| Ga0073909_104506852 | 3300005526 | Surface Soil | VINPKKLKGGKPYVIAFSVWAAWVVCRVGWAFIFS* |
| Ga0070733_110758241 | 3300005541 | Surface Soil | LVLLAIGFAATNRKKLKGSKSFTIALSVWAVYVVCRVGWAWIFS* |
| Ga0066693_102113402 | 3300005566 | Soil | AIGFAAVNPKKLKGGKSFTIAFSVWAVYVLCRVGWAFIFS* |
| Ga0066702_105044971 | 3300005575 | Soil | ILLAIGFAATNPKKLRGSKAFTIAFSVWAVYVVCRVGGAWIFS* |
| Ga0070762_110989822 | 3300005602 | Soil | AIGFAATNPKKLKGAKPYVIAFGVWAAYVVCRVGFAFAFS* |
| Ga0068864_1021991002 | 3300005618 | Switchgrass Rhizosphere | ATNPRKLRGGKAFTIVVTVWAVYVVLKVGRAFIFS* |
| Ga0075018_102318972 | 3300006172 | Watersheds | FTFWTLILLAIGFAAVNPKKLKGAKSFTIAFGVWAAFVVCRVGWAFIFS* |
| Ga0070716_1009799801 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LAIGFAAVSPKKLKGSKTYTIAFGVWAAFVVLRVCWAFIFS* |
| Ga0099795_103112312 | 3300007788 | Vadose Zone Soil | TLILLAIGFAAVNPKKLRGAKAFTIAFSVWAVFVVCRVGWAFIFS* |
| Ga0099830_100485692 | 3300009088 | Vadose Zone Soil | LLAIGFAAVNPKKLRGGKSYTIAFTVWAAFVVIRVGWAFIFS* |
| Ga0099828_107917822 | 3300009089 | Vadose Zone Soil | ATNPKKLRGSKAFTIAFSVWAVFVVCRVGWAFIFS* |
| Ga0066709_1013854511 | 3300009137 | Grasslands Soil | FDIFTFWILVLIAIGFAVANPKKLKGGKPFSIAFSVWAVWAVIRTGLAYVFS* |
| Ga0066709_1028151542 | 3300009137 | Grasslands Soil | LIAIGFAAVNPRKLKGAKSFTIAFTVWAVYVVLHVGWAFIFS* |
| Ga0116219_102286662 | 3300009824 | Peatlands Soil | WYLLLIAIGFAGTNPKKLKGGKSFTIAFSVMAVYLVLRVGIAFIFS* |
| Ga0134067_100394282 | 3300010321 | Grasslands Soil | LAIGFAAVNPKRLKGAKAFTIAFGVWAVYVVCRVGWAFIFS* |
| Ga0134065_104093381 | 3300010326 | Grasslands Soil | IGFAAVNPKKLKGGKSFTIAFSVWAIYVLCRVGWAFIFS* |
| Ga0126370_103155161 | 3300010358 | Tropical Forest Soil | AVNPKKLKGAKSFTIAFTVWAVYVVLRVGWAFIFS* |
| Ga0126370_108784771 | 3300010358 | Tropical Forest Soil | FDVFAFWTLILIAIGFAAVNPRKLKGAKSFTIAFSVWAVYVLCRVGWAFIFS* |
| Ga0126370_109996161 | 3300010358 | Tropical Forest Soil | TLCKQVDVFTFWILALIAIGFAAANPKKLKGAKAFTIAFSVWAVWVVLRTGIAFVFS* |
| Ga0126378_107582012 | 3300010361 | Tropical Forest Soil | LLAIGFAAVNPKKLKGAKPFTIAFTVWAVFTAIRVGGALIFS* |
| Ga0137393_105967641 | 3300011271 | Vadose Zone Soil | LLAIGFAAVNPKKLKGGKSYTIAFTVWAAFVVIRVGWAFIFS* |
| Ga0137389_107137131 | 3300012096 | Vadose Zone Soil | FAATNPKKLRGSKAFTIAFSVWAVFVLCRVGRAFIFS* |
| Ga0137383_102222102 | 3300012199 | Vadose Zone Soil | FWILILLAIGFSAVNPKKLKGAKSFTIAFTLWAVFLVIRVGIAFIFS* |
| Ga0137382_102951252 | 3300012200 | Vadose Zone Soil | FAAVNPKKLKGSKTYTIAFGVWAAFVACRVGWAFIFS* |
| Ga0137363_109317152 | 3300012202 | Vadose Zone Soil | LLAIGFAAVNPKKLKASKTYTIAFGVWAAFMACRVGWAFIFS* |
| Ga0137399_116601312 | 3300012203 | Vadose Zone Soil | WTLILLAIGFAATNPKKLRGSKAFTIAFSVWAVYVVCRVGGAWIFS* |
| Ga0137362_111420432 | 3300012205 | Vadose Zone Soil | AIGFAAVNPKKLKGAKSFTIAFGMWAAYAVCRVGWAFIFS* |
| Ga0137380_106732781 | 3300012206 | Vadose Zone Soil | FDIFTFWTLILLAVGFAAVNPKKLKGSKTYTVAFGVWAAFVACRVGWAFIFS* |
| Ga0137358_109287772 | 3300012582 | Vadose Zone Soil | WTLILLAIGFAATNPKKLKGSKAFTIAFSVWAVYVVCRVGGAWIFS* |
| Ga0137396_100379211 | 3300012918 | Vadose Zone Soil | MWTLILLAIGFAAVNPKKLKGGKSYTIAFTVWAAFVVIRVG |
| Ga0137419_115276492 | 3300012925 | Vadose Zone Soil | FWTLILLAIGFAAVNPKKLKGSKTYTIAFGVWAAFVACRVGWAFIFS* |
| Ga0137404_110221562 | 3300012929 | Vadose Zone Soil | FTFWILALTAIGFAAANPKKLKGGKAFTIVFSVWAVWVVLRVGWAFIWS* |
| Ga0137410_108582581 | 3300012944 | Vadose Zone Soil | IWMLVLLAIGFAAVNPKKLKGGTSYVIAFSVWGALVAVKVLWAFVAS* |
| Ga0164303_102557462 | 3300012957 | Soil | LILLAIGFAAVNPKKLKGSKPYMIAFTVYAVFVVLRVGFAFIFS* |
| Ga0134076_103706311 | 3300012976 | Grasslands Soil | GFAAVNPKRLKGAKAFTIAFGVWAVYVVCRVGWAFIFS* |
| Ga0164306_116955842 | 3300012988 | Soil | FSFWNLMLLAIGFGATNPRKLKGGKAFTIVFTVWVVYVVLKVGRALIFS* |
| Ga0137414_10308322 | 3300015051 | Vadose Zone Soil | LAIGFAAVNPKKLKGAKSFTIAFSVWAAYVVCRVGWAFIFS* |
| Ga0137420_10015692 | 3300015054 | Vadose Zone Soil | ILLAIGFAAVNPKKLKDAKSFTIAFSVWAAYVVCRVGWAFIFS* |
| Ga0182038_119080701 | 3300016445 | Soil | ILILLAIGFAAVNPKRLKGAKPFTIAFTVWAVFSAIRVGGALIFS |
| Ga0187802_103582342 | 3300017822 | Freshwater Sediment | FWTLILLAIGFAATSPKKLKGAKPYVIAFSVWAAFVVLRVGFAFIFS |
| Ga0187818_100225974 | 3300017823 | Freshwater Sediment | GFAAVNPRKLKGAKSFTIAFSVWAAFVILRVGWAFIFS |
| Ga0187824_103231752 | 3300017927 | Freshwater Sediment | FTIWTLVLLAIGFAVVNPKKLKGGKSYMIAFGVWAAFVVCRVGFAFIFS |
| Ga0187801_103863612 | 3300017933 | Freshwater Sediment | IAIGFAAVNPRKLKGATPFVIVFSVWGAFVVIRTLWAFIFS |
| Ga0187853_102990772 | 3300017940 | Peatland | LVLLAIGFAAVNPRKLKGSKPYVVAFSVWGVMVVVKVLWAFIFS |
| Ga0187819_106954901 | 3300017943 | Freshwater Sediment | IWTLVLIAIGFAAVNPRKLKGSKPYVIAFSVWGVVVFVKVVWAFISS |
| Ga0187776_104993601 | 3300017966 | Tropical Peatland | ILLAIGFAAVNPKKLKGAKPFMIAFSVWAAFLVIRVGAAFIFS |
| Ga0187816_100275811 | 3300017995 | Freshwater Sediment | TIWTLILIAIGFAAVNPRKLKGAKSFTIAFSVWAAFVILRVGWAFIFS |
| Ga0187770_110952341 | 3300018090 | Tropical Peatland | LILLAIGFAAVNPRKLKGSKPYVIAFSVWGALVVVKVLWAWVFS |
| Ga0066669_100173205 | 3300018482 | Grasslands Soil | ILLAIGFAAVNPKKLKGAKSFTIALTVWAVYVVCRVGWAFIFS |
| Ga0066669_117209831 | 3300018482 | Grasslands Soil | IFVFWILILLAIGFSAVNPKKLKGAKPFTIAFTVWAIYVLIRVGVAFIFS |
| Ga0210403_104053722 | 3300020580 | Soil | LWTLILLSIGFAATNPKKLKGSKAFTIAFSVWAVYVVCRVGSAWIFS |
| Ga0210403_105197631 | 3300020580 | Soil | TLILIAIGFAVTSPKRLKGSKPYVIAFGVWAAYVVCRVGFAFAFS |
| Ga0210399_113047412 | 3300020581 | Soil | FSAVNPKKLKGAKPFTIAFSVWAVFVLCRVGWAFIFS |
| Ga0210399_115443831 | 3300020581 | Soil | LAIGFATTNPKKLKGSKAFTIALSVWAVYVVCRVGSAWIFS |
| Ga0210401_103680152 | 3300020583 | Soil | VALLKSFDVFTFWTLILIAIGFAVTSPKKLKGSKPYVIAFGVWAAYVVCRVGFAFAFS |
| Ga0210404_106160612 | 3300021088 | Soil | AIGFAATNPKKLRGSKAFTIAFSVWAVYVVLRVGGAWIFS |
| Ga0210406_112911621 | 3300021168 | Soil | ATNPRKLKGSKSFSIAFGIWAAFVICRVGWAFIVS |
| Ga0210396_114127851 | 3300021180 | Soil | WMLILIAIGFAAVNPRKLKGAKPYTIAFTVWAVFVVIRTGWAFIFS |
| Ga0210388_100435331 | 3300021181 | Soil | TFWTLILIAIGFAVTNPKKLKGGKPYMIAFGVWAAYVVCRVGIAFIFS |
| Ga0210394_101247671 | 3300021420 | Soil | IAIGFAAVNPRKLKGAKSFTIAFSVWAVYVVCRVGWAFIFS |
| Ga0210402_1000942311 | 3300021478 | Soil | FSIWTLILLAIGFAATSPKKLKGGKPFAIAFGLWAAFVICRVGWAFAFS |
| Ga0210410_105511342 | 3300021479 | Soil | GIGFAATNPKKLKGGTSFGIAFGMFAAYVVIRVGLAFAFS |
| Ga0210409_103847061 | 3300021559 | Soil | GFAVTSPKKLKGSKPYVVAFSVWAAYVVCRVGFAFAFS |
| Ga0242655_101405292 | 3300022532 | Soil | WTLILIAIGFAVTNPKKLKGGKPYMIAFGVWAAYVVCRVGFAFIFS |
| Ga0208692_10281902 | 3300025472 | Peatland | IWILVLLAIGFAAVNPRKLKGSKPYVVAFSVWGVMVVVKVLWAFIFS |
| Ga0207685_101114892 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | WTMILLAIGFAATNPRKLRTGRAFAIVFAVWAAYVVLKVGRAFIFS |
| Ga0207660_106471431 | 3300025917 | Corn Rhizosphere | GFAVINPKKLKGGKPYVIAFSVWAAWVLCRVGWAFIFS |
| Ga0209239_13407222 | 3300026310 | Grasslands Soil | IAIGFAAVNPRKLKGAKSFTIAFTVWAVYVVLHVGWAFIFS |
| Ga0209154_12618911 | 3300026317 | Soil | ILLAMGFAAVNPKKLKGAKAFTIAFSVWAVYVVCRVGWAFIFS |
| Ga0209687_10357852 | 3300026322 | Soil | GFAAVNPQKLKGAKPFTIAFSVWAINVLCRVGWAFIFS |
| Ga0208324_11728651 | 3300027604 | Peatlands Soil | IDIFTVWTLVLLAIGFAAVNPRKLKGSKPYVVAFSVWGAMVVVKVLWAFVFS |
| Ga0209011_11492562 | 3300027678 | Forest Soil | LLAIGFAAVNPKKLRGSKTYTIAFGVWAAFVACRVGWAFIFS |
| Ga0209488_107705122 | 3300027903 | Vadose Zone Soil | GFAATNPKKLKGSKAFTIAFSVWAVYVVCRVGGAWIFS |
| Ga0209488_110303021 | 3300027903 | Vadose Zone Soil | ILLAIGFAATNPKKLKGSKAFTIAFSVWAAYVLCRVGWASIFS |
| Ga0209415_100907671 | 3300027905 | Peatlands Soil | LGKSFDVFTLWTLILIAIGFAAVNPKKLKGAKSFTIAFGVWAAYVVCRVGLAFIFS |
| Ga0209526_109959242 | 3300028047 | Forest Soil | KSFDIFVIWLLILLSIGFAAVNPKKLKGSKPYTIAFTVYAVFVVLRVCWAFIFS |
| Ga0222749_103929282 | 3300029636 | Soil | IGFAATNPRKLKGSKSFSIAFGIWAAFVICRVGWAFIVS |
| Ga0310039_103749011 | 3300030706 | Peatlands Soil | AIGFAGTNPKKLKGGKSFTIAFSVMAVYLVLRVGIAFIFS |
| Ga0310686_1066329381 | 3300031708 | Soil | ILIAIGFAATNPKKLKGAKPYVIAFGVWAAYVVCRVGFAFAFS |
| Ga0318502_107721921 | 3300031747 | Soil | TLVLLAIGFAAVNPKKLRGGKSYAIAFSVWGAMVVGKVLWAFVTS |
| Ga0307475_103666872 | 3300031754 | Hardwood Forest Soil | TLILLAIGFTAINPKKLKGAKSFTIAFTVWAVFVVCRVGWAFIFS |
| Ga0307475_106341932 | 3300031754 | Hardwood Forest Soil | IGFAAVNPKKLKGAKSFTIAFTVWAVFVVCRVGWAFIFS |
| Ga0306923_121385121 | 3300031910 | Soil | IWTLILLAIGFAAVNPKRLKTGKAIGIALTVWLAYVVVRTGIAWVMS |
| Ga0306921_103239911 | 3300031912 | Soil | IDIFTLWTLVLLAIGFAAVNPKKLRGSKSYAIAFSVWGAVVVVKVLWAFVTS |
| Ga0318556_103264522 | 3300032043 | Soil | LILLAIGFAAVNSKKLKGAKPFTIAFTVWALYVVCRVGWAFIFS |
| Ga0307470_102596022 | 3300032174 | Hardwood Forest Soil | SIGFAATNPKKLKGSKAFTIAFSVWAVYVVCRVGGAWIFS |
| Ga0307470_113119011 | 3300032174 | Hardwood Forest Soil | GFAATNPKKLKGGTSFGIAFGMFAAYVVIRVGLAFAFS |
| Ga0307471_10000010138 | 3300032180 | Hardwood Forest Soil | VIWILLLIAIGFAATNPKKLKGARAFTIAFTVFAAYVVIRMGIAFAFS |
| Ga0307471_1000489264 | 3300032180 | Hardwood Forest Soil | ALIGIGFAATNPKKLKGGTSFGIAFGMFAAYVVIRVGLAFAFS |
| Ga0307471_1033117831 | 3300032180 | Hardwood Forest Soil | FWNMMLLAIGFGATNPRKLRGGKAFTIVFTVWAVYVVLKVGRAFIFS |
| Ga0307471_1038848492 | 3300032180 | Hardwood Forest Soil | ILILIAIGFSAVNPKKLKGSKPYMIAFTVYGVFVVLRVGWAFIFS |
| Ga0307472_1012902212 | 3300032205 | Hardwood Forest Soil | AVNPKKLKGAKSFTIAFGVWAAYVVCRVGWAFIFS |
| Ga0306920_1024493222 | 3300032261 | Soil | TIWTLILLAIGFAAANPKKLKGSKAFSIAFSVWAAYVVLRVGWAFIFS |
| Ga0335078_118225631 | 3300032805 | Soil | KLILLGIGFSVLNPKKLKGAKPYTIIFGLFLVYIVIRVGIAFIFS |
| Ga0335081_117608681 | 3300032892 | Soil | TFWTLILLAIGFAATSPKKLKGAKPYVVAFSVWAVYVVLRVGWNFIFS |
| Ga0335081_121176661 | 3300032892 | Soil | WSLILIAIGFAAVNPKKMKTGKAMGIAFGVWIVFVVIRTGIAWVFS |
| Ga0335083_113842941 | 3300032954 | Soil | FAAVNPKKLKGGKSYTIVFGVFAVWVVCRVAWGFISS |
| Ga0316212_10031934 | 3300033547 | Roots | GFAATNPKKLKGAKPYVIAFGVWAAYVVCRVGFAFAFS |
| Ga0314864_0207033_34_171 | 3300033805 | Peatland | MLVLLAIGFAAVNPRKLAGSKPYVIAFSVWGAMVAVKVLWAFIFS |
| Ga0326724_0357395_1_138 | 3300034091 | Peat Soil | YLLLIAIGFAATNPKKLKGGKSFTIAFTVMAVYLVLRVGIAFIFS |
| ⦗Top⦘ |